SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000027659 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000027659
Domain Number 1 Region: 501-553
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.05e-19
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Domain Number 2 Region: 330-381
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000141
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number 3 Region: 450-501
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000273
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 4 Region: 197-220,299-326
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000192
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 5 Region: 576-607
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000185
Family Classic zinc finger, C2H2 0.035
Further Details:      
 
Domain Number 6 Region: 57-131
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000253
Family Classic zinc finger, C2H2 0.041
Further Details:      
 
Domain Number 7 Region: 368-411
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000162
Family Classic zinc finger, C2H2 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000027659   Gene: ENSBTAG00000020754   Transcript: ENSBTAT00000027659
Sequence length 677
Comment pep:known chromosome:UMD3.1:18:51373917:51378873:-1 gene:ENSBTAG00000020754 transcript:ENSBTAT00000027659 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEVVAEVAEVAEMPTQMSPRVMEMSAPILGEKMELSTELTEMTPGEAVASSLFFQFMCS
ECGNLYNTLEEVLSHQEQHVPTVTEEEALTTQDTGLEPELVPGTEEGPFQCGECSQLILS
PRELLAHQDAHLRESASQIQYQCGDCQELFPSPELWVAHRKAQHLSTAAAKPPVPPPLPP
VTPPPPPPAPLEVKMEPYECPECSTLCTTPEEFLEHQGTHFDSLEKEEHNGLEEEEEDDE
DDNEETEEEEEAAAEVGDDAKGGDKSAAGQAQGSGDGPPHCTSAGTRRRHRRASHGPASA
AHPFYCSQCQRSFSSANRLLAHGRAHVGGTHECTTCSKVFKKAASLEQHLRLHRGEARYL
CVDCGRGFGTELTLVAHRRAHTANPLHRCRCGKTFSNMTKFLYHRRTHAGKSGAPPSAAP
PTVASAVASLAPAEPTPPPPAPPTPPAQLPCPQCPKSFASASRLSRHRRAVHGPPERRHR
CGVCGKGFKKLVHVRNHLRTHTGERPFQCHACGKTFASLANLSRHQLTHTGVRPYQCLDC
GKRFTQSSNLQQHRRLHLRPVAFARAPRLPITGLYNKSPYYCGTCGRWFRAMAGLRLHQR
VHAQARTLTLQPPRSPPPAPPPPPEPQQTIMCTELGETIAIIETSQPLALADTLQLCQAA
LGASEASGLLQLDTAFM
Download sequence
Identical sequences A6QR00
ENSBTAP00000027659 NP_001095467.1.59421 NP_001095467.1.76553 XP_019835133.1.53367 ENSBTAP00000027659 9913.ENSBTAP00000027659

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]