SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000027787 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000027787
Domain Number 1 Region: 15-132
Classification Level Classification E-value
Superfamily POZ domain 3.34e-29
Family BTB/POZ domain 0.0000805
Further Details:      
 
Domain Number 2 Region: 359-415
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.64e-21
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 3 Region: 400-452
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.07e-17
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 4 Region: 320-372
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.61e-16
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000027787   Gene: ENSBTAG00000020854   Transcript: ENSBTAT00000027787
Sequence length 473
Comment pep:known chromosome:UMD3.1:19:27447122:27451108:1 gene:ENSBTAG00000020854 transcript:ENSBTAT00000027787 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSTATPEGALGYVREFTRHSSDVLGNLNELRLRGILTDVTLLVGGQPLRAHKAVLIACS
GFFYSIFRGRAGVGVDMLSLPGGPEAGGFAPLLDFMYTSRLRLSPATAPAVLAAATYLQM
EHVVQACHRFIQASYEPLGISLRPLEAEPPTPPTAPPPGSPRRSEGHPDPPTESRSCSQG
PPSPHSPDPKACNWKKYKFIILNSQASQAGSLARESSGQLCSQARLPSGDEASSSSSSEE
GPISSPQSRLSPTAATVQFKCEAPVNTRHQLTPQAPETTGSPSGRAHPPPGGEFFSCQNC
EAVAGCSSGLDPVASGDEDKPYKCQLCRSAFRYKGNLASHRTVHTGEKPYHCSICGARFN
RPANLKTHSRIHSGEKPYKCETCGSRFVQVAHLRAHVLIHTGEKPYPCPTCGTRFRHLQT
LKSHVRIHTGEKPYHCDPCGLHFRHKSQLRLHLRQKHGAATNTKVHYHILGGP
Download sequence
Identical sequences E1BGD3
ENSBTAP00000027787 ENSBTAP00000027787 XP_010845661.1.44457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]