SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000027794 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000027794
Domain Number 1 Region: 728-763
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000567
Family Classic zinc finger, C2H2 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000027794   Gene: ENSBTAG00000020861   Transcript: ENSBTAT00000027794
Sequence length 804
Comment pep:known chromosome:UMD3.1:12:91100867:91103281:1 gene:ENSBTAG00000020861 transcript:ENSBTAT00000027794 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVFQELRKTSARLECDHCNFRGTDYENVQIHMGTIHPEFCDEMDAGGLGKMIFYQKSAK
LFHCHKCFFTSKMYSNVYYHITAKHSAAEKWNEKPKNQFNKEGEPVKSPPLPEHQKTASS
SAELLKPAPALSIETQKLGPVASPESPEPAPLPSLDSQKPGPVVSPEPQTPSLPSPEPPK
PAPVSSPELPKPAPLVSESQKLVPVPSPEPQKLAPVSPEPIKATLTNPKPQKHSHFPETL
VPPSAPSPESPVLAASPEPWGPSPTASPESRKPAQTVSPEPRKLSPSVSPEPWKLFSAVS
SEPRRPAPSVSPGSWKPGPPGSPRSWKSSPSAASGPWKPAKPAPSVSPGPWKPTPSMSSA
SWKSSSVSSGSWKSPPASPESWKSGPPELRKTATTLSPEHWKTVPPESPELRKPGPTLSP
EIRSPAGSPELRKPSGSPEIWKFSPDQRKTSPASVDYPESQKSSRGGSPDLWKSSFFIEP
QKPVFPEIRKPGPSGPSESPKAASDIWKPVLSVSTEPRKPSLFSEPTKTAPPASPEPRKR
ALFPEPRKHALFPELPKSAIFSESQKVVELGDEPQADAIDDQKCDVLVQEELMATPKKLL
EDTLFPSSKKLKKDSQENSDAELSSSECIKADLDAVDGKGQESSSDQEQVDVESIDFSKE
NKMDITSPEQSKNVLQFTEEKEAFISEEEIAKYMKRGKGKYYCKICCCRAMKKGAVLHHL
VNKHNVHSPYKCTICGKAFLLESLLKNHVAAHGQSLLKCPRCNFESNFPRGFKKHLTHCQ
SRHNEEANKKLMEALEPPLEEQQI
Download sequence
Identical sequences F1MFQ9
ENSBTAP00000027794 ENSBTAP00000027794 NP_001192435.1.59421 NP_001192435.1.76553 XP_005214033.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]