SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000027915 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000027915
Domain Number 1 Region: 65-201
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.02e-38
Family Dual specificity phosphatase-like 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000027915   Gene: ENSBTAG00000020961   Transcript: ENSBTAT00000027915
Sequence length 227
Comment pep:known chromosome:UMD3.1:2:13503490:13519946:-1 gene:ENSBTAG00000020961 transcript:ENSBTAT00000027915 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHSLNQEIKAFSRNNLRKQCTRVTTLTGKKIIETWKDARIHVVEEVEPSGGGGCGYVQDL
SLDLKVGVIKPWLLLGSQDAAHDLDTLKRLKVTHILNVAYGVENAFLNDFIYKNISILDL
PETNILSYFPECFEFIEEAKMKDGVVLVHCNAGVSRAAAIIIGFLMNSEEISFTSAFSLV
KNARPSICPNAGFLEQLRTYQGGKESNKCDKLQELEEATVPELHSSQ
Download sequence
Identical sequences A6H7A7 L8IJ90
ENSBTAP00000027915 NP_001092348.1.59421 NP_001092348.1.76553 XP_005895481.1.15283 ENSBTAP00000027915 9913.ENSBTAP00000027915

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]