SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000027974 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000027974
Domain Number 1 Region: 494-542
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000046
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Domain Number 2 Region: 55-107
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000148
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 3 Region: 268-318
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000131
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000027974
Domain Number - Region: 162-213
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00289
Family Classic zinc finger, C2H2 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000027974   Gene: ENSBTAG00000021008   Transcript: ENSBTAT00000027974
Sequence length 716
Comment pep:known chromosome:UMD3.1:10:26053957:26056906:1 gene:ENSBTAG00000021008 transcript:ENSBTAT00000027974 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGSRPRAPVGHLAPSPPAFDGELDLQRYSNGPGVSAGSPGMGAVGWSESRAGERRFPCP
VCGKRFRFNSILALHLRAHPGAQAFQCPHCGHRAAQRALLRSHLRTHQPERPRSPAARLL
LELEERALLREARLGRPRSSGGLQATPATEGLPRPQASSSSAFRCPFCKGKFRTAAERER
HLHILHRPWKCGLCSFGSSQEEELLHHSLTAHGAPERPLAATSAAPQPQPPPQPEPRSVP
EPEPEPESEATPAPAPAAPEEPPAPPEFRCQVCGQSFTQSWFLKGHMRKHKASFDHACPV
CGRCFKEPWFLKNHMKVHASKLGPLRAPGPGSGPARAPQPPDLGLLAYEPLGPALLLAPA
PTPAERREPPSLLGYLSLRAGEARPNGEGAEPGAGRSFGSFRPLPSALPARARRHRAEEP
DEEEEVVEAEEETWARSRAVGPLASLPSRPGEAPGHSAPAAGAQARSTATQEENGLLVGG
ARPEGGRGATGKDCPFCGKSFRSAHHLKVHLRVHTGERPYKCPHCDYAGTQSGSLKYHLQ
RHHREQKSGAGPGPPPEPPPPSQRGSGQSSGAKAAPQPATWVEGRASPRPPASGGAPGSR
RKPASPGRTLRNGRGGEAEPLDLSLRAGPGGEAGPGGALHRCLFCPFATGAPELMALHLQ
VHHSRRARGRRPPQADASPPYARAPSGETPPTPPQEGEEGPGLLRSGEAGLGGQER
Download sequence
Identical sequences E1BCL9
ENSBTAP00000027974 ENSBTAP00000027974 9913.ENSBTAP00000027974 XP_010807426.1.76553 XP_010807427.1.76553 XP_010808621.1.59421 XP_010808623.1.59421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]