SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000028197 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000028197
Domain Number 1 Region: 47-343
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.74e-41
Family WD40-repeat 0.0021
Further Details:      
 
Domain Number 2 Region: 542-651
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.00000000000139
Family Ypt/Rab-GAP domain of gyp1p 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000028197   Gene: ENSBTAG00000021156   Transcript: ENSBTAT00000028197
Sequence length 1063
Comment pep:known chromosome:UMD3.1:14:18223496:18290297:-1 gene:ENSBTAG00000021156 transcript:ENSBTAT00000028197 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSTDLGSKESGKIWHRKPSPATRDGIIVNIIHNTSDYLPKVLRFLNVAFDSSGDCLIAG
DHHGNIYVFDLCGNRFNLVQRTAQACTALAFNLHRKSEFLVALADYSIKCFDTVTKELVS
WMRGHESSVFSISVHGSGRYAITTSSDTAQLWDLDTFQRKRKLNILQSVGIQKVFFLPLS
NTILSCFKDNSIFAWECDTLVCKYQLPAPPESSNILYKVFAVTRDGRILAAGGKSNHIHL
WCLEAKQLFRIIQMPTKVRAIRHLEFLPDSFDAGSNQVLGVLSQDGIMRFINIQTCKLLF
EIGSLDDGISSSVISPHGRYIASIMENGSLNIYSVQTLTKEINKPPPPLVKVIEDLPKKK
GNSGDLKVKVTSGRVRRPARSRESKIQTRILKQDLTCGFEKKENELSDGLNKKRLQILLK
GYGEFPTKYRMFIWRSLLQLPENQTAFSNLIDKGIHVAFLNLQKKYPIKSRKLLRVLQRT
LSALAHWSAIFSDTPYLPLLAFPFVKLFQNNQLICFEVVATLIINWCQHWFEYFPNPPIN
ILSMIENVLAFHDKELLQHFINHDVTSQLYAWPLLETVFSEVLTREEWLKLFDNVFSNHP
SFLLMTVVAYNICSRAPLLNCKRKDDFEYFFHHRNNLDISAVIREAYRLLDTTPADIHPD
SMLDAFVALTKGQYPVFNQYPKFIVDYQTQERERIRNDELDYLRERQAVEEMQAEVDQQR
VEDEAWYQKQELLRRAEETRREILLQEEEKMIQQRQRLAAVRRELKVKEMHLQDAARRRL
LQLQQDQREMELRRLDDEIERKVHMRDREIAATAKDLEMRHLELESQKRLYEKNLSRNQE
AVAKEMKENADAYRQKVDVEEHMFHRLIGTDQTQNQKIHKLIEENLAKAEQACLNTDWRI
QALHKQRCSDLHRNECYQEIAKLLRKNRKKEIEVLNAMMEGEAKKWEEAEEKDFHLKSEK
KTAALSDASRRWFLEKEIHDAQHPCDKVVPKGRDEEFASGCLPRASQLNDISEMESLTQI
SLNQRKMHWDAMEQDLMERVRNLRQRLVTQAQNRCQTPHLLAT
Download sequence
Identical sequences Q29RL0
NP_001039538.1.59421 NP_001039538.1.76553 9913.ENSBTAP00000028197 ENSBTAP00000028197 ENSBTAP00000028197

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]