SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000028273 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000028273
Domain Number 1 Region: 313-369
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.3e-21
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 2 Region: 191-243
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.76e-19
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 3 Region: 457-509
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.45e-19
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 4 Region: 121-170
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.38e-18
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 5 Region: 550-601
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.05e-17
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 6 Region: 274-326
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.21e-17
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000028273   Gene: ENSBTAG00000031806   Transcript: ENSBTAT00000028273
Sequence length 626
Comment pep:known chromosome:UMD3.1:25:26831623:26835977:1 gene:ENSBTAG00000031806 transcript:ENSBTAT00000028273 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERAVGPWGSDLRSSEEREQLRGARTGLGSEHAEISQPDEFEHAPQEDDLEFKEEEDLAP
GHEVGNASLKPEGIQTWDDLWVQREGPGKPQARDRGPRLLGEPRWGQASDRAAVCGECGK
SFRQMSDLVKHQRTHTGEKPYKCGVCGKGFGDSSARIKHQRTHSGEKPYRARAPAQGPPK
IPRSRIPAGERPTICGECGKSFRQSSDLVKHQRTHTGEKPYKCGICGKGFGDSSARIKHQ
RTHRGEQPPRPVVPRRQPSRAATAAAQGPKAQDKPYICTDCGKRFVLSCSLLSHQRSHLG
PKPFGCDVCGKEFARGSDLVKHLRVHTGEKPYLCPECGKGFADSSARVKHLRTHSGERPH
ACPECDRTFSLSSTLLRHRLTHMEPQDFSFPGYPLAPLIPSPPPSSSPPPPPLGTSPPLT
PRSPSHSGDGPFGLPGLEPEPGGPQAGEPPPPLEGDKPHKCPECGKGFRRSSDLVKHHRV
HTGEKPYLCPECGKGFADSSARVKHLRTHRGERARPPPPSTLLRPHNPPGPAPTAPRSRV
RAQPSGPSQPHVCGFCGKEFPRSSDLVKHRRTHTGEKPYKCAECGKGFGDSSARIKHQRG
HLILRPFGTGDGRARPLKEEPPMGLE
Download sequence
Identical sequences F1N0K1
ENSBTAP00000028273 ENSBTAP00000028273 9913.ENSBTAP00000028273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]