SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000028333 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000028333
Domain Number 1 Region: 4-117
Classification Level Classification E-value
Superfamily POZ domain 1.96e-24
Family BTB/POZ domain 0.00084
Further Details:      
 
Domain Number 2 Region: 561-601
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.78e-22
Family Classic zinc finger, C2H2 0.00095
Further Details:      
 
Domain Number 3 Region: 692-742
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000151
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Domain Number 4 Region: 537-560
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000536
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000028333
Domain Number - Region: 815-846
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000418
Family Classic zinc finger, C2H2 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000028333   Gene: ENSBTAG00000030836   Transcript: ENSBTAT00000028333
Sequence length 847
Comment pep:known chromosome:UMD3.1:1:143737582:143755849:-1 gene:ENSBTAG00000030836 transcript:ENSBTAT00000028333 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGLLHYINPAHAISLLSALNEERLKGQLCDALLIVGDQKFRAHKNVLAASSEYFQSLFT
NKENEAQTVFQLDFCEPDAFDNVLNYIYSSSLFVEKSSLAAVQELGYSLGISFLTNIASK
TPQAPFPTCPNRKKTFTEDEENSSQKRSVIVCQSRNEAPGKAGSQNTPELSHPPRPSASI
AVKANASKPPGPKPTEPPHHVAPAEKSWPKDGPAVLARPPELAGPLEEPSRGGLAKRAVA
PPSKPPPDRAAVDERPGASALLPKGVAVELALRSPRPPVLSLRGSPETPFLLKEAGRGSG
PGEDRNLLYYSRLGLVIPAGAPAPGTQGVDRSGPLVKSLLRRSLSMDSQVPVYTPTAELQ
APPGAGSGDVAGSVLSAFSSQRPPSKDGGETVAPDTRTPAPQPHRLRSFSASQPAERPGA
PQGPEVRVKAEPRSPPEPCDIIRVTVGDAAAATRDLALQTEDDRKDPSRLPAKRRFQTDR
RLPAKQPKAESPGSPGSGDPREEGSSPSALRADFPGSDLNKDEFEQGNHERLCRTATVCP
YCSLRFFSPELKREHEGKCEFRKLTCLECMRTFKSAFSIWRHQVEVHNQNSMAPAAGTSP
PRPDLNGEATGPARPLVPPEPGRADPAATAAKDDPAGGGRGPEPVNFDSEDSTCLPEDLS
LSKPLKIQVKEEPPEEAEEEAPEAGAAPKDLWPCEKCGKTFPAPKQLERHQELLCSVKPF
ICHVCNKAFRTNFRLWSHFQSHMAQASEDPAHRDPEAGPGPAGSPSPPPLPPPLPKIQPL
EPDSPTGLPETPTPTADKLFAPRESDTLFYHAPPLSAITFKRQFMCKLCHRTFKTAFSLW
SHEQTHN
Download sequence
Identical sequences A2VDQ3
ENSBTAP00000028333 9913.ENSBTAP00000028333 NP_001077128.1.59421 NP_001077128.1.76553 ENSBTAP00000028333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]