SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000028575 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000028575
Domain Number 1 Region: 268-325
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.16e-24
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 2 Region: 772-829
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.4e-24
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 3 Region: 437-493
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.92e-24
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 4 Region: 660-717
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.06e-23
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 5 Region: 716-773
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.57e-23
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 6 Region: 492-549
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.88e-23
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 7 Region: 324-381
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.65e-23
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 8 Region: 604-661
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.27e-22
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 9 Region: 380-437
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.92e-22
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 10 Region: 814-866
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.17e-21
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 11 Region: 548-605
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.1e-21
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 12 Region: 19-69
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.14e-20
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 13 Region: 230-282
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.46e-19
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 14 Region: 857-897
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000103
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000028575   Gene: ENSBTAG00000015899   Transcript: ENSBTAT00000028575
Sequence length 903
Comment pep:known chromosome:UMD3.1:18:59894613:59917943:1 gene:ENSBTAG00000015899 transcript:ENSBTAT00000028575 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CWPEEALKLRKRKEKESGMALSQKRLTSEDVAIEFTQEEWEFLDPAQRALYRDVMLETYR
NLLSVDISPTHVIKHLQPKGNSYKRETFQTLMLGRPESCDIKHFHLWESQENTCDFECQG
RDDKQNYKGTPVSLNGNMPDGIDSHDGKDAGIKPFGSRLGFNFQDKLQIFQTGRIISEYN
EVERSVNNSLSFSPLQTIPPCAQISVSNIYGNDFINPSVVTQDLKAHREKSYKCDECGKA
FRVKSTLLSHQTVHTGEKPYKCDECGKAFRLKSILLSHQTVHTGEKPYKCDECGKAFRLK
SFLLTHQTVHTGEKPYKCDECGKAFRAKSTLLSHQTIHTGEKPYKCNECGKVFTHSSNLR
RHQKIHTGQKLFKCHICDKVFSRSEHLAGHQSVHSGEKPYKCNECGKHFNQPSKFISHKR
LHTGEKPYKCDECGKDFSQPSQFISHKRLHTGEKPYKCDECGKDFHVKSILLRHQTVHTG
EKPYKCDECGKAFRVKSILLSHQTVHTGEKPYKCDECGKAFTDSSNLRRHQKIHTGQKLF
KCDICYKVFSEREQLAGHQSVHSGEKPYKCDECGIAFHVKSILLRHQTVHTGEKPYKCDE
SGKAFHVKSTLLRNQRVHTGEKPYKCDVCGKAFSEKSVLLSHQTVHTGEKLYKCVECGKA
FRVKAILLTHQTVHTEEKPYKCDECGTAFRVKSMLLNHQTVHTGEKPYKCDECGKAFHEK
SILFRHQTVHTGEKPYKCDECDKAFCVKSTLFRHQTVHTGQKPYKCDECGKAFCIKSILL
SHQRVHTGEKPYKCDECSKAFRVKSTLLRHQTVHTGEKPYKCDECGKVFSQKPHLQLHWR
IHTGERPFRCDECGKFFSRNSHLTSHRRIHIEQPFKCFKCGKSFTQVSALIKHEKIHILN
TFS
Download sequence
Identical sequences F1MVJ7
ENSBTAP00000028575 ENSBTAP00000028575

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]