SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000028669 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000028669
Domain Number 1 Region: 11-142
Classification Level Classification E-value
Superfamily POZ domain 3.45e-26
Family BTB/POZ domain 0.00081
Further Details:      
 
Domain Number 2 Region: 359-410
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.25e-19
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 3 Region: 395-447
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000139
Family Classic zinc finger, C2H2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000028669   Gene: ENSBTAG00000021512   Transcript: ENSBTAT00000028669
Sequence length 538
Comment pep:known chromosome:UMD3.1:3:15634915:15648928:-1 gene:ENSBTAG00000021512 transcript:ENSBTAT00000028669 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSPEDDLIGIPFPDHSSELLSCLNEQRQLGHLCDLTIRTQGLEYRTHRAVLAACSHYFK
KLFTEGGGGALSGAGGGGTAAGGAGAGVCELDFVGPEALGALLEFAYTATLTTSSANMPA
VLQAARLLEIPCVIAACMEILQGSGLEAPSPDEDDCERARQYLEAFACTATASASGVPNG
DDSPPQAPLPPPPPPPPRPVARRSRKPRKAFLQTKGARANHLVPEVPTVPTHPFTYEEEE
ETGRVGSGLGDSYSPPTGAASPPEGPLSYEACEGEEEEEELVYPPPYGLAQGGGPPLSPE
ELGSDEDAIDPDLMAYLSSLHQDTLPPGLDSQDKLVRKRRSQMPQECPVCHKIIHGAGKL
PRHMRTHTGEKPFACEVCGVRFTRNDKLKIHMRKHTGERPYSCSHCPARFLHSYDLKNHM
HLHTGDRPYECHLCHKAFAKEDHLQRHLKGQNCLEVRTRRRRKDDAPPHYPPPSAATSSP
AGLDLSNGHLDTFRLSLPRFWETSAPTGPPDSTPGPPDDDEEEGAPTTPQAEGAMDTS
Download sequence
Identical sequences E1BGW3
ENSBTAP00000028669 ENSBTAP00000028669 XP_005203736.2.76553 XP_005203738.1.76553 XP_005203740.1.76553 XP_005203741.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]