SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000028717 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000028717
Domain Number 1 Region: 888-1186
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 7.62e-90
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000987
Further Details:      
 
Domain Number 2 Region: 213-356
Classification Level Classification E-value
Superfamily PH domain-like 3.38e-31
Family Third domain of FERM 0.0067
Further Details:      
 
Domain Number 3 Region: 105-212
Classification Level Classification E-value
Superfamily Second domain of FERM 2.75e-27
Family Second domain of FERM 0.00046
Further Details:      
 
Domain Number 4 Region: 18-104
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.51e-20
Family First domain of FERM 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000028717   Gene: ENSBTAG00000021553   Transcript: ENSBTAT00000028717
Sequence length 1190
Comment pep:known chromosome:UMD3.1:16:70619178:70749808:1 gene:ENSBTAG00000021553 transcript:ENSBTAT00000028717 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPFGLKLRRTRRYNVLSKNCFVTRIRLLDSSVIECTLSVESTGQECLEAVAQRLELRETH
YFGLWFLSKSQQARWVELEKPLKKHLDKFANEPLLFFGVMFYVPNVSWLQQEATRYQYYL
QVKKDVLEGRLRCSLEQVIRLAGLAVQADFGDYNQFDSQDFLREYVLFPMDLALEEAVLE
ELTQKVAQERKAHSGILPAEAELMYINEVERLDGFGQEIFPVKDNHGNSVHLGIFFMGIF
VRNRIGRQAVIYRWNDMGNITHNKSTILVELVNKEETALFHTEDIENAKYISRLFATRHK
FYKQNKICTEQSNSPPPIRRQPTWSRSSLPRQQPYILPPMHVQCGEHYSETHTSQDSIFH
GNEEALYCNSHNSLDLSYLNGTVTNGGSVCSVHSVNSLSCSQSFIQASPVSSNLSIPGSD
IMRADYIPSHRHSAIIVPSYRPTPDYETVMRQMKRGVVHTDSQSQSLRNLNIINTHAYNQ
PEDLVYSQPEMRERHPYTIPYGPQGGYGNKLVSPSDQLNPTNPTVPSKPGGPSAISHTVS
TPELANMQLQGAHSYNAAHVLKNYLFRPPPPYPRPRPATSTPDLASHRHKYVSGSSPDLV
TRKVQLSVKTFQEDSSPVVHQSLQEVSEPLTATKHHGAVHKRHSLEAMSSMVRGMEAMTL
KSLNIPMARRSTLREPGPPEEGPGSHEVPQLPQYHHKKTFSDATMLIHSSESEEEEEEEA
PDPVPQIPVLREKVEYSTQLQAALARIPNKPPPEYPGPRKSVSNGALRQDQACLPPAVAR
ARLLRHGPAKAISVSRADQLAVNGASLGPSISEPDLTSVKERVKKEPVKERPVSEMFSLE
DSIIEREMMIRNLEKQKMACLEAQKRPLMLATLNGLSVARGSGREESRVDATRVPMDERF
RTLKKKLEEGMVFTEYEQIPKKKANGIFSTAALPENAERSRIREVVPYEENRVELIPTKE
NNTGYINASHIKVVVGGAEWHYIATQGPLPHTCHDFWQMVWEQGANVIAMVTAEEEGGRT
KSHRYWPKLGSKHSSATYGKFKVTTKFRTDSGCYATTGLKVKHLLSGQERTVWHLQYTDW
PDHGCPEDVQGFLSYLEEIQSVRRHTNSMLEGTRNLRPPIVVHCSAGVGRTGVVILSELM
IYCLEHNEKVEVPMMLRLLREQRMFMIQTIAQYKFVYQVLIQFLQNSRLI
Download sequence
Identical sequences E1BEZ8
ENSBTAP00000028717 XP_005217418.1.76553 ENSBTAP00000028717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]