SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000028840 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000028840
Domain Number 1 Region: 196-269
Classification Level Classification E-value
Superfamily EF-hand 0.0000101
Family Penta-EF-hand proteins 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000028840   Gene: ENSBTAG00000021643   Transcript: ENSBTAT00000028840
Sequence length 576
Comment pep:known chromosome:UMD3.1:22:56965859:56983710:1 gene:ENSBTAG00000021643 transcript:ENSBTAT00000028840 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDSNEEYEAAFRSLLPICRSKSLLDDENASKEPVFNPEAVIAHCFKQFKQEDFHLPRSR
RRVIILPQKEAPKPVRPTPQLQTPLEPTPSPKAPEVGDTQEQPEDPRAWLRQRLKMRKDL
ESFGNVERWLQNKANLTLSKAKVLRDIHKKQPVARLPSQLAMIRDTAKKSQQPSRRQVPQ
LRLPKPPALSTLYSYLHCRKIKILELFHKVDQGKHQISREEFIVALKAIGVPLKNQEVED
IVVYLSSLGKHNSITMDNLASTYKQWSLARQQSTLTIATEDSRSSNDSGSTQSSSPKQKA
NVPPEAPKMDLLTVPVVDTEMEARPMTLEEMEDVGKHYRERKRQNKLALPSIQYTEQCRL
VRSGDKHFDEHCLPTTVHGEMGSILNRSRVDTFLVYLQCWKVCEAHGLPLTEDILMRALM
YPGDKIIFQKDEMRPIRQPGGYYSDFKPFTENLALVRPQGVPVPVPQKKPDKKMPKKIKK
INFKEFEEFTRKLKEKKPSSPQLTHPNFFWPGHLLDKLRLYLPTVTMDRSLAIFSCVQQR
PHVYPATYHSDCWWPIKDVNYVTYAYYDAHKIYHIN
Download sequence
Identical sequences E1BCB9
ENSBTAP00000028840 ENSBTAP00000028840 9913.ENSBTAP00000028840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]