SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000028846 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000028846
Domain Number 1 Region: 121-215
Classification Level Classification E-value
Superfamily Immunoglobulin 1.83e-22
Family I set domains 0.0000899
Further Details:      
 
Domain Number 2 Region: 26-119
Classification Level Classification E-value
Superfamily Immunoglobulin 7.69e-17
Family I set domains 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000028846   Gene: ENSBTAG00000021647   Transcript: ENSBTAT00000028846
Sequence length 290
Comment pep:known chromosome:UMD3.1:18:62838472:62849020:1 gene:ENSBTAG00000021647 transcript:ENSBTAT00000028846 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPRDITLFCLVLCLGQKIQAQDENFPIPIISATPSSVIPWNGSVKILCQGTLESYLYQL
EILENLTYKQVEKKLGFQEVAEFIINHMDTNTAGRYQCRYRRGHRWSAPSEALELVLTGL
YDKPFLSTDGGHVVMPGENISFQCSSAYISFDRFSLSRPGGATLSRHRDARLQGDFTLGP
VNLSFSGVYTCYGWHSGHPYVWSAPSNALELVVTDTTSQDHTTENWVRMGVAGLVLLALL
AILAENRLGPQLPHQEDQQDLPDLSWSWQRSQTERTFGLTPKDHQGDSWS
Download sequence
Identical sequences G5E5S0
ENSBTAP00000028846 ENSBTAP00000028846 9913.ENSBTAP00000028846

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]