SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000029169 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000029169
Domain Number 1 Region: 165-417
Classification Level Classification E-value
Superfamily Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor 2.09e-79
Family Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor 0.0000686
Further Details:      
 
Domain Number 2 Region: 1-139
Classification Level Classification E-value
Superfamily SNARE-like 1.16e-39
Family Clathrin coat assembly domain 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000029169   Gene: ENSBTAG00000021883   Transcript: ENSBTAT00000029169
Sequence length 418
Comment pep:known chromosome:UMD3.1:28:30168233:30189053:-1 gene:ENSBTAG00000021883 transcript:ENSBTAT00000029169 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIHSLFLINCSGDIFLEKHWKSVVSQSVCDYFFEAQEKAADVENVPPVISTPHHYLISIY
RDKLFFVSVIQTEVPPLFVIEFLHRVADTFQDYFGECSEAAIKDNVVIVYELLEEMLDNG
FPLATESNILKELIKPPTILRSVVNSITGSSNVGDTLPTGQLSNIPWRRAGVKYTNNEAY
FDVVEEIDAIIDKSGSTVFAEIQGVIDACIKLSGMPDLSLSFMNPRLLDDVSFHPCIRFK
RWESERVLSFIPPDGNFRLISYRVSSQNLVAIPVYVKHSISFKENSSCGRFDITIGPKQN
MGKTIEGITVTVHMPKVVLNMNLTPTQGSYTFDPVTKVLTWDVGKITPQKLPSLKGLVNL
QSGAPKPEENPSLNIQFKIQQLAISGLKVNRLDMYGEKYKPFKGVKYVTKAGKFQVRT
Download sequence
Identical sequences A0A024QZR5 A0A1S3FYH1 A0A1U7UPA4 A0A212CPY3 A0A2J8U5I4 D2HEE3 F2Z4I2 F7IFP3 G1P0S6 G1S4J0 G3R698 H2R420 Q5R478 Q9Y2T2 S7MTT6 U6CPK1 W5PFM2
ENSPTRP00000046433 gi|46370095|ref|NP_996895.1| gi|6912240|ref|NP_036227.1| ENSGGOP00000010841 ENSP00000347408 ENSGGOP00000010841 ENSOARP00000009237 ENSBTAP00000029169 ENSNLEP00000020428 ENSP00000347408 ENSP00000361831 ENSPPYP00000002697 ENSP00000347408 ENSP00000361831 ENSPTRP00000046433 ENSAMEP00000017578 ENSMLUP00000003372 ENSNLEP00000020428 NP_001127013.1.23681 NP_001274044.1.84170 NP_001307192.1.87134 NP_001307192.1.92137 NP_001307193.1.87134 NP_001307193.1.92137 NP_036227.1.87134 NP_036227.1.92137 NP_996895.1.87134 NP_996895.1.92137 XP_001147572.1.37143 XP_001147644.1.37143 XP_001147723.1.37143 XP_002920437.1.58354 XP_003271315.1.23891 XP_003271316.1.23891 XP_003271317.1.23891 XP_004021533.1.66739 XP_004049666.1.27298 XP_004049667.1.27298 XP_004273138.1.21590 XP_004383269.1.4749 XP_004769425.1.14098 XP_005226428.1.76553 XP_005226429.1.76553 XP_005226430.1.76553 XP_005389988.1.28644 XP_005619116.1.84170 XP_005864717.1.60319 XP_006050830.1.26621 XP_006050831.1.26621 XP_006090298.1.53796 XP_006733517.1.47382 XP_006761056.1.95426 XP_006915562.1.64745 XP_007110632.1.24612 XP_007110633.1.24612 XP_007110634.1.24612 XP_007110635.1.24612 XP_007110636.1.24612 XP_007110637.1.24612 XP_007166637.1.59432 XP_007166638.1.59432 XP_007166639.1.59432 XP_008067147.1.4292 XP_008694284.1.72690 XP_008694285.1.72690 XP_008694287.1.72690 XP_009007933.1.60252 XP_009243726.1.23681 XP_009243727.1.23681 XP_009457031.1.37143 XP_010850655.1.44457 XP_010850656.1.44457 XP_010850657.1.44457 XP_010850658.1.44457 XP_011224720.1.58354 XP_011353592.1.92234 XP_011960769.1.66739 XP_011960770.1.66739 XP_012315597.1.9421 XP_012881084.1.60039 XP_014312593.1.53796 XP_014393846.1.60319 XP_015986310.1.101085 XP_019601446.1.88060 XP_019601447.1.88060 XP_019791565.1.83887 XP_019791566.1.83887 XP_019791567.1.83887 XP_019791568.1.83887 XP_019809392.1.53367 XP_019809393.1.53367 XP_019809394.1.53367 XP_019809395.1.53367 XP_021555122.1.83697 XP_021555123.1.83697 XP_021555124.1.83697 ENSAMEP00000017578 ENSBTAP00000029169 ENSMLUP00000003372 ENSCJAP00000047475 GO.36937 ENSPPYP00000002697 9598.ENSPTRP00000046433 9600.ENSPPYP00000002697 9606.ENSP00000347408 9913.ENSBTAP00000029169 ENSCJAP00000002338

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]