SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000029408 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000029408
Domain Number 1 Region: 37-98
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.48e-26
Family KRAB domain (Kruppel-associated box) 0.00087
Further Details:      
 
Domain Number 2 Region: 274-331
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.55e-23
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 3 Region: 414-471
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.85e-23
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 4 Region: 470-527
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.45e-22
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 5 Region: 330-387
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.61e-21
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Domain Number 6 Region: 237-288
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.3e-17
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 7 Region: 512-564
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000307
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 8 Region: 377-409
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000021
Family Classic zinc finger, C2H2 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000029408   Gene: ENSBTAG00000016257   Transcript: ENSBTAT00000029408
Sequence length 634
Comment pep:known chromosome:UMD3.1:17:74560555:74570229:-1 gene:ENSBTAG00000016257 transcript:ENSBTAT00000029408 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CELLPEPQVTAAPQEDPARPLKEIAEDTLPRGLLEARSEESVTFKDVAVDFTQEEWGQLD
SPQRALYRDVMLENYQNLLSLGPPVCKPDVISHLERGEEPWQAPRDGPAGPDPGEWGAEA
EPLPAAPGCLELERQEHLHVECSHEGLSVWTQPPRAPPSPPGSLQSGLASGFLQTPASPP
AAAPPAPPPPRRPSRPTSSPPPLPPHLLPAAAALAPSLPPRPPPWLRRRSQGAGSGPFAC
GECGKAFPRSAALALHRRWHAREKAYKCGECGKAFSWSTNLLEHQRVHTGEKPFLCGQCG
KAFSCHSSLNVHRRVHTGERPYKCGQCAKAFSCSSLLGMHRRVHTGERPYRCGECGKAFN
QRTHLTRHHRVHTGEKPYCCAACGRAFACHSSLAAHEKLHSGDKPFRCSDCQKAFSSRSR
LTLHQRAHTGEKPFQCGQCAKAFSCHAYLVVHQRVHSGEKPFRCDECGKAFSSHSYLIVH
QRVHTGEKPFDCSRCWKAFSCHSSLIVHQRVHTGERPYKCSQCGRAFSQNHCLVKHQKTH
SAEKAFKCHERGEVFGWSGPLAEHRRLHGGEKPFAVQLDQRLLSPYYVPGGLPGAGASGG
SSVGPVDARDVAELLGVAPPSGSRSFSLGSNPRN
Download sequence
Identical sequences F1MSE6
ENSBTAP00000029408 ENSBTAP00000029408

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]