SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000029837 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000029837
Domain Number 1 Region: 37-154
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 9.16e-39
Family Frizzled cysteine-rich domain 0.0000594
Further Details:      
 
Domain Number 2 Region: 170-281
Classification Level Classification E-value
Superfamily TIMP-like 0.0000000000000105
Family Tissue inhibitor of metalloproteinases, TIMP 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000029837   Gene: ENSBTAG00000018563   Transcript: ENSBTAT00000029841
Sequence length 294
Comment pep:known chromosome:UMD3.1:17:3829564:3838136:1 gene:ENSBTAG00000018563 transcript:ENSBTAT00000029841 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQGPGSLLLIVLASHCCLGSARGLFFGQSDFPYKRSNCKPIPANLQLCHGIEYQNMRLP
NLLGHETMKEVLEQAGAWIPLVMKQCHPDTKKFLCSLFAPVCLDDLDETIQPCHSLCVQV
KDRCAPVMSAFGFPWPDMLDCDRFPQDNDLCIPLASSDHLLPATEEAPKVCEACKTKNED
DNDIMETLCKNDFALKIKVKEITYINRDTKIILETKSKTIYKLNGVSEKDLKKSVLWLKD
SLQCTCEEMNDINAPYLVMGQKLGGELVITSVKRWQKGQREFKRISRSFRKLQC
Download sequence
Identical sequences L8I1X6 Q3SX29
9913.ENSBTAP00000029837 ENSBTAP00000029837 NP_001029565.1.59421 NP_001029565.1.76553 XP_005903858.1.15283 XP_006070174.1.26621 XP_010839024.1.44457 ENSBTAP00000029837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]