SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000030064 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000030064
Domain Number 1 Region: 313-380
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.2e-16
Family PHD domain 0.0037
Further Details:      
 
Domain Number 2 Region: 205-233
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000721
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 3 Region: 266-328
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000128
Family PHD domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000030064   Gene: ENSBTAG00000003077   Transcript: ENSBTAT00000030078
Sequence length 391
Comment pep:known chromosome:UMD3.1:29:44205032:44217694:1 gene:ENSBTAG00000003077 transcript:ENSBTAT00000030078 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVVENVVKLLGEQYYKDAMEQCHNYNARLCAERSVRLPFLDSQTGVAQSNCYIWMEKR
HRGPGLASGQLYSYPARRWRKKRRAHPPEDPRLSFPSIKPDTDQTLKKEGLISQDGSSLE
ALLRTDPLEKRGAPDPRVDDDSLGEFPVTNSRARKRILEPDDFLDDLDDEDYEEDTPKRR
GKGKSKSKGVGSARKKLDASILEDRDKPYACDICGKRYKNRPGLSYHYAHSHLAEEEGED
KEDSQPPTPVSQRSEEQKSKKGPDGLALPNNYCDFCLGDSKINKKTGQPEELVSCSDCGR
SGHPSCLQFTPVMMAAVKTYRWQCIECKCCNICGTSENDDQLLFCDDCDRGYHMYCLTPS
MSEPPEGSWSCHLCLDLLKEKASIYQNQNSS
Download sequence
Identical sequences A1E461 A6QQS0 F7A7X5 K9IJJ1 W5PY56
9913.ENSBTAP00000030064 ENSOARP00000015390 ENSBTAP00000030064 NP_001093826.1.59421 NP_001093826.1.76553 NP_001272540.1.57651 XP_002755572.1.60252 XP_004019718.1.66739 XP_006056546.1.26621 XP_011972596.1.54773 XP_019501108.1.44202 XP_019810518.1.53367 XP_020762100.1.74333 ENSBTAP00000030064 ENSCJAP00000004192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]