SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000030196 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000030196
Domain Number 1 Region: 188-244
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.61e-25
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 2 Region: 383-440
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.67e-24
Family Classic zinc finger, C2H2 0.003
Further Details:      
 
Domain Number 3 Region: 439-496
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.97e-22
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 4 Region: 495-552
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.57e-21
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 5 Region: 327-384
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.08e-20
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 6 Region: 243-300
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.04e-19
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 7 Region: 132-188
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.97e-19
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 8 Region: 76-132
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.7e-17
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 9 Region: 18-76
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000239
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 10 Region: 291-322
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000157
Family Classic zinc finger, C2H2 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000030196   Gene: ENSBTAG00000020185   Transcript: ENSBTAT00000030211
Sequence length 559
Comment pep:known chromosome:UMD3.1:X:39517281:39579616:1 gene:ENSBTAG00000020185 transcript:ENSBTAT00000030211 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PQNLPVEHHFACKECGDTFRLKVLLVQHQRIHSEKKGWECSDCGQVFHGVTELNEHREQM
EKEAKPFECEECGKRFKKNAGLSQHLRVHSREKPFDCEECGRSFKVNTHLFRHQKLHTSE
KPFACKTCSRDFLDRQELLKHQRIHTGHLPFDCDDCGKSFRGVNGLAEHQRIHSGAKPYG
CPHCGKLFRRSSELTKHRRIHTGEKPYECGQCGKAFRQSSSLLEHQRIHTGERPYACGDC
GKAFRGPSDLIKHRRIHSGLKPYECDKCGKAFRRSSGLSRHRRTHSGTRRCECSECGRVF
KRRSALQKHQPTHHTERRFVCQQCGKSFTRNSSLVKHQVIHSGVKPFKCGECGRHFQHKF
SLTEHQRTHSGEKHYTCGECGKTFTRGSSLMKHQIIHTGEKPYGCDECGKRFGRKFTLTE
HQRIHSGERPYSCDVCGKAFTRSSNLIEHQRTHSSEKPYTCSQCPKAFKGISQLIHHQRV
HKEEKPFMCKECGKAFRGHSGLSQHRPVHTGEKPYECSECGKTFSRRFNLLNHQIVHIEK
RPYVCQECGKAFHHSSAFL
Download sequence
Identical sequences F1N130
ENSBTAP00000030196 ENSBTAP00000030196

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]