SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000030209 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000030209
Domain Number 1 Region: 7-126
Classification Level Classification E-value
Superfamily POZ domain 6.28e-34
Family BTB/POZ domain 0.00064
Further Details:      
 
Domain Number 2 Region: 397-449
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.16e-16
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 3 Region: 449-505
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000232
Family Classic zinc finger, C2H2 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000030209   Gene: ENSBTAG00000009210   Transcript: ENSBTAT00000030224
Sequence length 615
Comment pep:known chromosome:UMD3.1:29:36988682:37011135:-1 gene:ENSBTAG00000009210 transcript:ENSBTAT00000030224 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVKTFTHSSSSHSQEMLGKLNMLRNDGHFCDITIRVQDKIFRAHKVVLAACSDFFRTKL
VGQAEDENKNVLDLHHVTVTGFIPLLEYAYTATLSINTENIIDVLAAASYMQMFSVASTC
SEFMKSSILWNTPNSQPEKGLDAGQENNSNCNFTSRDGSISPVSSECSVVERTIPVCRES
RRKRKSYIVMSPESPVKCSTQTSSPQALNSSTSYSENRNQPVDSSLAFPWTFPFGIDRRN
QPDKVKQAENTRTLELPGPSETGRRMTDYVTCESTKTALPLGAEEDVRVKVERLSDEEVH
EEVSQPVSASQSSLSDQQTVPGSEQVQEDLLISPQSSSIGSVDEGITEGLPTLQGTSSTS
AHVDDDDRLENVQYPYQLYIAPSTSSTERPSPNGPDRPFQCPTCGVRFTRIQNLKQHMLI
HSGIKPFQCDRCGKKFTRAYSLKMHRLKHEGKRCFRCQICSATFTSFGEYKHHMRVSRHI
IRKPRIYECKTCGAMFTNSGNLIVHLRSLNHEASELANYFQSSDFLVPDYLNQEQEETLV
QYDLGEHSFESNSSVQMPVISQVSSTQNCESTFPLGSLGLTEKEEEMPEQPKTSACAEAT
RDDPPKSELSSITIE
Download sequence
Identical sequences F1MYU9
ENSBTAP00000030209 9913.ENSBTAP00000030209 ENSBTAP00000030209 XP_005197373.1.59421 XP_005226926.1.76553 XP_015316711.1.76553 XP_015325509.1.59421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]