SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000030565 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000030565
Domain Number 1 Region: 4-63
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 9.55e-23
Family KRAB domain (Kruppel-associated box) 0.00083
Further Details:      
 
Domain Number 2 Region: 319-376
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.1e-22
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 3 Region: 179-236
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.06e-22
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 4 Region: 263-320
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.19e-22
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 5 Region: 375-432
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.08e-20
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 6 Region: 445-497
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000111
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 7 Region: 226-258
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000109
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 8 Region: 146-193
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000472
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000030565   Gene: ENSBTAG00000006093   Transcript: ENSBTAT00000030588
Sequence length 507
Comment pep:known chromosome:UMD3.1:15:3699421:3700944:1 gene:ENSBTAG00000006093 transcript:ENSBTAT00000030588 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPLESVTFGDVAIDFTQEEWNLLDKSQKNLFRNVMLETVTHLVSVGYQISKSDVVFQLE
QGKELWTQAAGGFQGQSPGSESLFRQQEMTLMQSVYWKHTSPVRTMQVSHTQGDPAECAD
LGDEVTPTSSLQYSIVPFRSKHNVSKQHGKSLSQGSFLNGQGHIHTRHKSCECALCGKVF
NRCSSLSRHKMIHTGEKPFKCQLCEKVFNQRFSLKVHEKTHTGEKPYECHQCGKAFSRCA
SLRRHSMIHTGEKPFKCQLCEKVFNQRFSLKVHEKTHTGEKPYECHQCGKAFSRCASLRR
HSMIHTGEKPFKCQLCEKVFNQRFSLKVHEKTHTGEKPYECHQCGKAFSRCASLRRHSMI
HTGEKPFKCHLCGKVFNQNSSLKQYERTHTGEKRYECHQCGKAFLQSSGLSSHKKVHAGE
KPHVCLECGKAFTHSSGLHVHKRIHIKEKSHVCSVCRKAFNKYAKLREHERTHSGEKPYE
CQLCGEHFTRASSLRQHKGTQHRRENQ
Download sequence
Identical sequences F1N0R1
ENSBTAP00000030565 ENSBTAP00000030565

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]