SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000030910 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000030910
Domain Number 1 Region: 5-120
Classification Level Classification E-value
Superfamily POZ domain 3.14e-28
Family BTB/POZ domain 0.0012
Further Details:      
 
Domain Number 2 Region: 433-489
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.32e-20
Family Classic zinc finger, C2H2 0.0084
Further Details:      
 
Domain Number 3 Region: 530-582
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.49e-19
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 4 Region: 489-545
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.23e-18
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 5 Region: 394-446
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.26e-17
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000030910   Gene: ENSBTAG00000014680   Transcript: ENSBTAT00000030945
Sequence length 766
Comment pep:known chromosome:UMD3.1:6:107416938:107443062:-1 gene:ENSBTAG00000014680 transcript:ENSBTAT00000030945 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPVAAHSCHLLQQLHEQRIQGLLCDCMLVVKGVCFKAHKNVLAAFSQYFSRSLFQNSSG
QKNDVFHLDIKNVSGIGQILDFMYTSHLDLNQDNIQVMLDTAQCLQVQNVLSLCHTFLKS
ATIDQPPGLPCHGTFSLQSTLTPDTNCVLSENYPPHLLPECSAGAQQCRAVDGSLSHAPP
SVGLHPPTAETSKQAPDPFDGSCTELPFKQPNCYYKLRNLYSKQYYKHASCPSHERVTEQ
PFTFSASADLHAEDRRPYAVGHTECVLESSQHLPSNFLAQPLGENAPDPASDHAGQQPTR
QMRLKKAIHLKKLNFLKSQKSAEQTSEPKPDDSLTMRLEAAREHGVEKVNSPSAEEKESE
ELSNSENFNGVSETERPEDPAALEDQTQLPQSQRQYACELCGKPFKHPSNLELHRRSHTG
EKPFECNICGKHFSQAGNLQTHLRRHSGEKPYICEICGKRFAASGDVQRHIIIHSGEKPH
LCDICGRGFSNFSNLKEHKKTHTADKVFTCDECGKSFNMQRKLVKHRIRHTGERPYSCSA
CGKCFGGSGDLRRHVRTHTGEKPYTCDVCNKCFTRSAVLRRHKKTHCRASDEGPGALEAL
ARAIEAPDLERSQSSDSFSQDVSVPLMPAVTVKIPTHPVDEDSVAGFDSPCKFQPVAQPQ
HGPSESEKLSLEPVKLAKPPHVPPAQHQAYGYPDVDAPAGAEPLQADGVAALRSSLAALD
HPPCTDPLGSRAAAPAYRNSEGQFFSSMTLWGLAMKTLQNESELDQ
Download sequence
Identical sequences E1BHF9
ENSBTAP00000030910 ENSBTAP00000030910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]