SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000031069 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000031069
Domain Number 1 Region: 1666-1716
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.25e-17
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 2 Region: 1602-1660
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000202
Family Classic zinc finger, C2H2 0.03
Further Details:      
 
Domain Number 3 Region: 1527-1579
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000687
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 4 Region: 1380-1430
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000897
Family Classic zinc finger, C2H2 0.03
Further Details:      
 
Domain Number 5 Region: 1704-1759
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000504
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 6 Region: 582-619
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000364
Family C2HC finger 0.045
Further Details:      
 
Domain Number 7 Region: 216-250
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000537
Family HkH motif-containing C2H2 finger 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000031069   Gene: ENSBTAG00000022887   Transcript: ENSBTAT00000031106
Sequence length 2211
Comment pep:known chromosome:UMD3.1:24:3841029:4197665:-1 gene:ENSBTAG00000022887 transcript:ENSBTAT00000031106 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMDPGKKLGSDEGDHVNEEAEHPSHSASHGVDRGPVSDETADSAENSTNKRGFAESSDLD
HIVEEDNGNKRASKRMKLAEAEPLGPGEPRTHGSGSPEGTGSGEGVALPGSEVEPLSSGR
DGSPGLPGHPSPGEMAAEKEPAQETTAFLDLGGEPPSPPKEMRGSGALGGPCACSPVSCP
HVEKHAVRPSPRPEDQACGPAADGGLAFPGHTGQARGPPRAFSCELCGFQCAEENLLNAH
CLGKTHLRRQNLAARGGFVQILTKQPLPKKPSPVGAKAGRTKPRASRPVARNGDSKALRS
VGAGTFRDFRGSFSKQSGHGSELRVEMRPSRNTSPEKMEVVEENVTSHDAAGNPENQSRK
LGMAVTSERLLDRLESSRNTAQAAPGLSTASRPRAERGFLVLGSGFRRRAGAFALKGQVK
KRCGLLGVSKRGANEVQRLYSKHLRAPIKMSDAESAPLHGDPRLIPPETQAPKQDRTNAH
LPGSSDSLARRPAPDHQVACTCSACGHTATSRAELEIHVTRCHVGELRFHCQTCGFSSTS
RRDVEEHAHSHQHQQTASGLRCQCCLFTSPNEVDLRDHMKEKHSMGFLCPPCHLFFSSEK
DMEEHRATEKHIHLLGQTKSSQSFNGDSALQTFPLSTLESENAKVSVSEAGKSAQEEPAK
SRVSHGNEARHSSKPQFQCKKCFYKTRSSTVLTRHIKLRHGQDYHFLCKACNLYSLSKEG
MEKHIKRSKHLENAKKNNIGLSFEECIERVCIGANDKKEELTVPGNGRTEGHGEGVQIQE
QSCLDQSILPPQELSLSGVITKEGELAPPPTPKRGRPKGNISRTCSHCGLLASSITNLTV
HIRRKHSHQYSYLCKVCKYYTVTKGDMERHCATKKHKGRVEIEASGKQSSDIVVGPEGGN
LDASRKNTSVADEPANPPVEADTSVSEQPPLEQGSPVEVEVENVFHPEDRETGSHLIEKK
EQTSVDPEDLQGDTCPQKDDASTDENRCTHCEFKAHSSTSLELHVKRKHTREFAFYCMAC
DYYAVTRREMTRHAATEKHKMKRQSYLNSTNVQASSSEVSKTIIIPQGQQQQNSEEFQII
SDQPSETLKSRNAADCSILDENTSLDMSKVFCASDSVETETEEDSNLSEDHSFCETFQQP
LAKDKVIKPEEMVPLSISSNCGSPSKFQNENSGSSALNHETAKKRHSMLNDISSPNTHGE
SDGGNAEDKADKVLGKRGCLRAVDGEHPAKSAMLTAPRDLLNLGSSDQDRAGSMQSSGDL
KDVPGDPVLESKEILMNSRHETKVILEEDGPASDSTIDNNDVYETIISIDDKGQAVYSFG
RFDSSIIRIKNPEDGELFDQSQEGLVAAGVRMSELPLKDCAQGVKKKKADSSSFVESTRI
RCDDCGFLADGLSGLNVHIAMKHPTKEKHFHCLLCGKSFYTESNLHQHLASAGHMRNEQA
SVEELPEGGATFKCVKCTEPFDSEQNLFLHIKGQHEELLREVNKYIVEDTEQINREREEN
QGNVCKYCGKMCRSSNSMAFLAHIRTHTGSKPFKCKICHFATAQLGDARNHVKRHLGMRE
YKCHVCGVAFVMKKHLNTHLLGKHGVGTPKERKFTCHLCDRSFTEKWALNNHMKLHTGEK
PFKCTWPTCHYSFLTASAMKDHYRTHTATGEKSFLCDLCGFAGGTRHALTKHRRQHTGEK
PFKCDECNFASTTQSHLTRHKRVHTGEKPYRCPWCDYRSNCAENIRKHILHTGKHEGVKM
YNCPKCDYGTNIPVEFRNHLKEQHPDIENPDLAYLHAGIVSKSYECRLKGQGATFVETDS
PFTAAALAEESPVKDRPLRSSRRPAAPPEPVQQVIIIQGYEGEFALDASVEETAAATLQT
LALAGQVARVVHITEDGQVIAAGQSGAQGGSGAPSPGLPEPLADGATQVVVVGGSMEGHG
MDEPLSPSGAVIQQVTKQEILGLAEAGVPPPDAASALDALLCAVTELGGAEGPAAAEEKG
RAGPRDVLVQLPGQEAATPAAPEIHVFHDGPDGAAATEPVEVLTQLVRPAAVIASQERAQ
VAFKKVVQGMLQFAVCDSAAAGQLMKDGVTQVIVNEEGTVHMLAREGSQIIMQEAEARGP
HVDLAEADGEISQIIVTEELVQAMVQESGGGFPEGATHYIVTELPPGVQDEPAVYSHTVI
EAAGSQELLQAGAVVPSGAEQLTSMVIYTQEGSPAAAVIQSQRDSSEVHEA
Download sequence
Identical sequences E1BF46
ENSBTAP00000031069 ENSBTAP00000031069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]