SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000031285 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000031285
Domain Number 1 Region: 198-316
Classification Level Classification E-value
Superfamily EF-hand 1.91e-35
Family Osteonectin 0.0087
Further Details:      
 
Domain Number 2 Region: 286-379
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 6.54e-26
Family Thyroglobulin type-1 domain 0.00065
Further Details:      
 
Domain Number 3 Region: 134-180
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000079
Family Ovomucoid domain III-like 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000031285   Gene: ENSBTAG00000008827   Transcript: ENSBTAT00000031330
Sequence length 424
Comment pep:known chromosome:UMD3.1:28:28304694:28329730:-1 gene:ENSBTAG00000008827 transcript:ENSBTAT00000031330 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRARGCGRLALPLLLLSAAALAEGDAKGLKEGETPGNFMEDEQWLSSISQYSGKIKHWNR
FRDEVEDDYIKSWEDNQQGDEALDTTKDPCQKVKCSRHKVCIAQGYQRAMCISRKKLEHR
IKQPAVKLHGNKDTICKPCHMAHLASVCGSDGHTYSSVCKLEQQACLSSKQLTVRCEGPC
PCPTEQAATSTSDSKPETCTGQDLADLGDRLRDWFQLLHENSKQNGSANSGASPASGLDK
SLGASCKDSIGWMFSKLDTSADLFLDQTELAAINLDKYEVCIRPFFNSCDTYKDGRVSTA
EWCFCFWREKPPCLAELERIQIQEAAKKKPGIFIPSCDEDGYYRKMQCDQSSGDCWCVDQ
LGLELTGTRTHGSPDCDDIVGFSGDFGSGVGWEDEEEKETEEAGEETEEEEGEAGEADDG
GYIW
Download sequence
Identical sequences A7MB04
9913.ENSBTAP00000031285 ENSBTAP00000031285 ENSBTAP00000031285 NP_001094585.1.59421 NP_001094585.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]