SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000031689 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000031689
Domain Number 1 Region: 38-126
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 5.49e-29
Family SCAN domain 0.00017
Further Details:      
 
Domain Number 2 Region: 553-577,605-632
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000093
Family Classic zinc finger, C2H2 0.032
Further Details:      
 
Domain Number 3 Region: 2061-2135
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000985
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number 4 Region: 1888-1911,1940-1967
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000126
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 5 Region: 2276-2350
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000849
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 6 Region: 448-482
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000485
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 7 Region: 877-908
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000056
Family Classic zinc finger, C2H2 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000031689   Gene: ENSBTAG00000023338   Transcript: ENSBTAT00000031743
Sequence length 2352
Comment pep:known chromosome:UMD3.1:18:64270787:64282112:-1 gene:ENSBTAG00000023338 transcript:ENSBTAT00000031743 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPPKSLSATKPKKWAPNLYELDSDLSEPDAVPGEGATDSEFFHQRFRNFLYVEFIGPRK
TLLKLRNLCLDWLQPEIRTKEEIIEVLVLEQYLSILPERIKPWVYARKPETCEKLVALLE
DYEAMYEPEDDNSSDTHSEGGMSRRAAESPPPRPALPCCSDRERRRGRSRDMESRDRWPS
VRSPRSRFHQRDLALPLAERAKEREHRRRDSLLDLDARSEEAVLYQDMVALTEDRKPQNP
IQDNMENYRKLLSLGVQLAEDDGHSHMTQGHSARSKRSAYPSTSRGLKTAPETKKSAHRR
GICEAESSHGVIMEKFIKDVARSSRSGRARESSERPHRLSRRAGGDWKEASFSRREAGAS
ERGPEGGAFGGGGFSCGSDLVSKKRALERKRRYHFDAEGQGPVHDPRGGARKRPFECGGE
ARRAAKAAGASSLSAPPAAPSQPLDFGAMPYVCDECGRSFAVISEFVEHQIVHTRESLYE
YGESFIHSAAVSEAQSRPEGARRSEGAQAAGLAEHRGGQAQEHLRGSGDEEQDEPFLPSP
TFSELQKMYGKDKFYECKVCKETFLHSSALIEHQKIHNHEDREKERSTGAVRRTPMLGEL
QRACGKEKRYECKVCGETFHHSAALREHQKTHGRGSPSEGRARAFEETFIPGQSLKRRQK
TYSKEKLYDFREGGDAFGRSSDFMEHQKIHSRKSYFDSRGYEKPLLHSMSMPGSQKSHTI
TRPPEDEDEEKAFTASSSPEDGQEARGYERSAYERAILHSLAAFRPPRGLREDGEPSTYL
SGLRDPPQKTPAWESPYAGGRHSFFRSSVFYRASRPAPLDHLAGEGPSGWQRDGEASGPS
SDGRQHQKARAKKKNIERKNYDASMMHSLHFGESQTFRPRERFYECLECGEFFVRSSELA
EHQKIHNRKKLSGSKNYLRSVLRSLSSTDPQTSYQGQSVQMSYPQEAAQTSYAELAAQTS
YAEEPAQTSYAVEPAQTSYAEEPAQTSYTEAPAEASYTEEPAQTSCIEEPAQTSYTNPAA
ETSYAEEPAQTSYTEAPAEASYTEEPAQTSCIEEPAQTSYTNPAAETSYTEEPAQTSYTE
APAEASGIEEPAQTNYTEESAEVSYTEEPSQTSCIEEPAQTSYTDPAAETSYTEEPAQTS
YTQEPAQTSCTEEPAQTSCTEEPAQTSYTQEPAQTSYTKEPAEASYTEEPAQTSCIEEPA
QTNYTKESAKASYTEEPAQTTQTSYTDPAAETSYTEEPAQTNYTVESAEASYTEEPSQTS
CIEEPAQTSYTDSAADTSCTEEPAQTSCTEEPAQTSYTQEPAQTSCTEEPAQTSCTEEPA
QTSYTQEPAQTSCTEEPAQTSYTQEPAQTSCTEEPAQTSYTEEPAQTSYTEEPAQTSYTQ
EPAQTSYTQEPAQTSYTEEPAQTSYTEEPAQTSYAQEPAQTSYAEEPAQTSYAEEPAQTS
YTQEPAQTNYTEEPAEASYTEEPAQTSYAEEPAQTSYPEEPAQTSYAEEPAQTSYAEEPA
QTSYPEEPAQTSYTEEPAQTSYAKEPAQTSYPEEPAQTSYAEEPAQTSYAEEPAQTSYAE
EPAQTSYSEEPAQTRYTNQLRSDMRKNQLRPDMPRNQLRPVMPRNQLRPDMPRNQPRPVI
LRNQLRPDMPRNQPRPVILRNQLRPDMLGNQLRPDMPGNQLRPDMLRPPAETSYAELVAQ
ISYAELVTPTSYAELAAETGYFEPPAQTSYTEPAETNYADPAAQVSFDEPPAEASYADLA
AEISYAELAAETSYADLAAQISYDEPPAETSYAELAAQISYSEPADQTSYAELAAQTSYS
EPLAQTSYAELTSETSYCEQPVLNECKECGECFATVEDLGRHQKIYAREKFHDGKLFGEP
VMQDLGLDGSPEEELEEQEEPEEPEDSIYGCKDCGLGFADRADLRDHQKVHGREYLVDSR
EYTHPAVHMPPVSEYQKDCLGEQLYECPACGESFVHSSFLFEHQKVHEQDQFYGHRRYEP
FMQPLIVSPRRPQAPQKSAPAGVGPQCQVCGQDFIHASVLSEHARGHAGEGLPDQGQGGA
GAAGPGPAPTEPQQDPGEEQRYECETCGESFPSQADLQEHMRVHEKGEPYDYGAAFVHTS
FLTEPPKRDWPFYECKDCGKSFIHSTILTKHQKLHLQEEGAAAAAAATAQEAEANVLVPR
EVLRIQGSNVEAAEPEVEAAEPEVEAAEPEVEAAEPLGEAEGPEWEAAEPSGEAEQPHAE
AEQPDMDADEPDGAGIEDPEERAEEPEGDDDEPDGAGIEDPEEEGEEQEIQVEEPYYDCG
ECGETFPSGAAYAEHLTAHASLVILEPAGLYGEGAGGPEGGRPDDELFKCDVCGQLFSDR
LSLARHQNTHTG
Download sequence
Identical sequences F1MBU3
ENSBTAP00000031689 ENSBTAP00000031689

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]