SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000031693 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000031693
Domain Number 1 Region: 105-161
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.64e-24
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 2 Region: 160-217
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.7e-22
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 3 Region: 202-254
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.38e-19
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 4 Region: 48-105
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.46e-18
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 5 Region: 11-62
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000292
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 6 Region: 308-357
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000171
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Domain Number 7 Region: 244-299
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000217
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 8 Region: 344-402
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000111
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000031693   Gene: ENSBTAG00000034597   Transcript: ENSBTAT00000031747
Sequence length 460
Comment pep:known chromosome:UMD3.1:26:12250737:12252652:-1 gene:ENSBTAG00000034597 transcript:ENSBTAT00000031747 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VHEITQIDDQIYECLECEQNFCENLALLMCERTHTGEKPYRCDMCEKTFIQSSDLISHQR
IHSYEKPYKCSKCEKSFWHHLALSGHQRMHAGKKFYTCDICAKNFGQSSDLLVHQRSHTG
EKPYLCSECDKCFSRSTNLIRHQRTHTGEKPFKCLECEKAFSGKSNLISHQRTHTGERPY
KCNKCEKSYRHRSAFIVHKRVHTGEKPYKCGACEKCFGQKSDLIVHQRVHTGEKPYKCLE
CMRSFTRSANLIRHQATHTHTFKCLEYEKSFSCSSDLIVHQRIHMEEKPHQWSACDSGFL
LGMDFVAQQKMRTQTEELHYKYSVCDKSFHQSSALLQHQTIHFGEKPYICNVAEKDFPQS
SDFIGNHINHSSEKPYKCPEFLENLSPSSCLITHKRIYTGGKLTSSVNVRKLSSNAHLSS
FQRSHTGENLCICLECGKSIKMRKTSVNDQFLYTRKSLPY
Download sequence
Identical sequences F1MBT9
ENSBTAP00000031693 ENSBTAP00000031693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]