SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000032008 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000032008
Domain Number 1 Region: 122-432
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.22e-77
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000203
Further Details:      
 
Domain Number 2 Region: 4-120
Classification Level Classification E-value
Superfamily tRNA-binding arm 0.000000000356
Family Seryl-tRNA synthetase (SerRS) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000032008   Gene: ENSBTAG00000001780   Transcript: ENSBTAT00000032066
Sequence length 459
Comment pep:known chromosome:UMD3.1:18:48896564:48905591:-1 gene:ENSBTAG00000001780 transcript:ENSBTAT00000032066 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESLCAYPEDAARALDLRKGELRSKDLPGIISTWQELRQLREQIRSLEEEKEAVTEAVRA
LVVNQDNSQVQQDPQYQSLRARGREIRKQLTLLYPKEAQLEEQFYLRALRLPNQTHPDVP
VGDESQARVLHVVGDKPAFSFQPRGHLEIAEKLDIIRQKRLSHVSGHRSYYLRGAGALLQ
HGLVNFTLNKLIHRGFTPMTVPDLLRGVVFEGCGMTPNAKPSQIYNIDPSRFEDLNLAGT
AEVGLAGYFMDHSVAFRDLPIRMVCSSTCYRAETDTGKEPWGLYRVHHFTKVEMFGVTGP
GLEQSSELLEEFLSLQMEILTELGLHFRVLDMPTQELGLPAYRKFDIEAWMPGRGRFGEV
TSASNCTDFQSRRLHIMFQTEAGELQFAHTVNATGCAVPRLLIALLESYQQKDGSVLVPP
ALQPYLGTDRITTPTHVPLQYIGPNQPQKPRLPGQPASS
Download sequence
Identical sequences G8JKV4
ENSBTAP00000002334 ENSBTAP00000032008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]