SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000032154 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000032154
Domain Number 1 Region: 403-460
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.83e-24
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 2 Region: 347-404
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.1e-23
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 3 Region: 487-544
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.51e-23
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 4 Region: 239-292
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.07e-22
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 5 Region: 291-348
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.17e-20
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 6 Region: 7-63
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.19e-19
Family KRAB domain (Kruppel-associated box) 0.0016
Further Details:      
 
Domain Number 7 Region: 196-256
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.87e-17
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 8 Region: 529-581
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.07e-16
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 9 Region: 450-482
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000515
Family Classic zinc finger, C2H2 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000032154   Gene: ENSBTAG00000009895   Transcript: ENSBTAT00000032217
Sequence length 588
Comment pep:known chromosome:UMD3.1:18:45731750:45746037:-1 gene:ENSBTAG00000009895 transcript:ENSBTAT00000032217 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPALALISFEDVAITFTGEEWRHLDLAQRTLYQEVMLETCGLLVSLGHPVPKAELIHL
LEYGPELWTVKRGLSRNTCTGEKANPKTTELTASQLALTEEAPFEEQVTHGTSRDSWLGQ
ARYQEKLSEMQEGNWRPGADPYKETCLRKLSHKHDDFETGDSLCLGILQEQVSIQDALHE
CDSQEPGRDLVVDARNNLYKCKECGKDFSKNWALTRHQQIHAGVKPYECSECGKASRYMA
DFIRHMRFHTGEKPYKCIECGKAFKRRSYLTEHQRIHSGDKPYECKECGKAFTHRSSFTQ
HNMTHTREKPFLCKECGKAFYYSSSFTQHMRIHTGKKLYECSKCGKAFTRQSTFIQHNMT
HTGEKPFLCKECGKAFCLNSSFTQHMRIHTGEKPYECSECGKAFTHRSTFIRHKRAHTGE
KPFECKECGKAFCDSSSLIQHVRIHTGERPYECSECGKAFTHHYIFIRHNRTHSGKKPLE
CKECTKAFYYSSSFTRHMRIHTGEKPYVCRECGKAFTQSANFVRHNRIHTGEKPYECKER
EKAFCDNFALTQHVRTHTGEKPFECGECGKAFSHSSSFTHHQKIHTRV
Download sequence
Identical sequences F1MX03
ENSBTAP00000032154 ENSBTAP00000032154 NP_001179289.1.59421 NP_001179289.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]