SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000032217 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000032217
Domain Number 1 Region: 372-424
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000089
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 2 Region: 7-111
Classification Level Classification E-value
Superfamily POZ domain 0.000000000000136
Family BTB/POZ domain 0.0015
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000032217
Domain Number - Region: 414-452
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000209
Family Classic zinc finger, C2H2 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000032217   Gene: ENSBTAG00000023611   Transcript: ENSBTAT00000032282
Sequence length 489
Comment pep:known chromosome:UMD3.1:18:46616259:46619888:1 gene:ENSBTAG00000023611 transcript:ENSBTAT00000032282 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLSPTRLPSPYASDRLVRLAARLRPALCDTLITVGSQEFPAHSLVLAGVSQQLGRRGRW
AVVKGISPSTFAQLLHFVYGESLELHPGELGPLEEAARTLGVQSLEEACFRARRDMAREE
LGPGLKKQEELEKPTRDSMRGVGAFGEKQRPEKFVRAGGKEQETLHRPRPPRESPDTAEA
ILEGRGEQMRPKEQLHQALVGHGRVGGKQEVVMWLRDSARGSEESLREFPGPLPPAGSFQ
TGITPSPWWAEAPWLGEGQSALWSILLLPPRYGTPFSHSIPMTGAWQEVWPPDQRIPLSL
NLHKGLWSQNQLASSSPTPGSLPQVPTQLSPGETEESDQRRTGELATCVGQVGTASHPSL
PHPPPPTPARSRPYSCSVCGKRFSLKHQMETHYRVHTGEKPFSCSLCPQRSRDFSAMTKH
LRTHGAAPYRCPLCQAGCPSLASMQAHMRGHSPSQLPPGWTIRSTFLYSSSSRPSRASTS
PSRPSSSTT
Download sequence
Identical sequences E1BHU5
9913.ENSBTAP00000032217 ENSBTAP00000032217 ENSBTAP00000032217 NP_001178153.1.59421 NP_001178153.1.76553 XP_005219101.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]