SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000032241 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000032241
Domain Number 1 Region: 2628-2916
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.4e-71
Family Protein kinases, catalytic subunit 0.00000108
Further Details:      
 
Domain Number 2 Region: 1236-1415
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.22e-52
Family DBL homology domain (DH-domain) 0.0000000135
Further Details:      
 
Domain Number 3 Region: 1876-2069
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.7e-50
Family DBL homology domain (DH-domain) 0.000014
Further Details:      
 
Domain Number 4 Region: 1422-1542
Classification Level Classification E-value
Superfamily PH domain-like 6.97e-34
Family Pleckstrin-homology domain (PH domain) 0.00000213
Further Details:      
 
Domain Number 5 Region: 2070-2187
Classification Level Classification E-value
Superfamily PH domain-like 3.44e-31
Family Pleckstrin-homology domain (PH domain) 0.00063
Further Details:      
 
Domain Number 6 Region: 2510-2619
Classification Level Classification E-value
Superfamily Fibronectin type III 1.23e-25
Family Fibronectin type III 0.00074
Further Details:      
 
Domain Number 7 Region: 2426-2530
Classification Level Classification E-value
Superfamily Immunoglobulin 2.8e-24
Family I set domains 0.0066
Further Details:      
 
Domain Number 8 Region: 234-370
Classification Level Classification E-value
Superfamily Spectrin repeat 4.45e-19
Family Spectrin repeat 0.0051
Further Details:      
 
Domain Number 9 Region: 1054-1191
Classification Level Classification E-value
Superfamily Spectrin repeat 1.28e-17
Family Spectrin repeat 0.0071
Further Details:      
 
Domain Number 10 Region: 456-597
Classification Level Classification E-value
Superfamily Spectrin repeat 2.02e-17
Family Spectrin repeat 0.0052
Further Details:      
 
Domain Number 11 Region: 798-957
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000328
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 12 Region: 2276-2339
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000001
Family SH3-domain 0.0000323
Further Details:      
 
Domain Number 13 Region: 1601-1666
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000366
Family SH3-domain 0.0033
Further Details:      
 
Domain Number 14 Region: 147-265
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000183
Family Spectrin repeat 0.0084
Further Details:      
 
Domain Number 15 Region: 4-137
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.0000000327
Family CRAL/TRIO domain 0.017
Further Details:      
 
Domain Number 16 Region: 602-722
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000864
Family Spectrin repeat 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000032241   Gene: ENSBTAG00000002640   Transcript: ENSBTAT00000032306
Sequence length 2941
Comment pep:known chromosome:UMD3.1:1:69248613:69724961:1 gene:ENSBTAG00000002640 transcript:ENSBTAT00000032306 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLAGGRDKRGGPILTFPARSNHDRIRQEDLRKLVTYLASVPSEDVCKRGFTVIIDMRGSK
WDLIKPLLKTLQEAFPAEIHVALIIKPDNFWQKQKTNFGSSKFIFETSMVSVEGLTKLVD
PSQLTEEFDGSLDYNHEEWIELRLSLEEFFNSAVHLLSRLEDLQEMLARKEFPVDVEGSR
RLIDEHTQLKKKVLKAPVEELDREGQRLLQCIRCSDGFSGRNCIPGSADFQSLVPKITSL
LDKLHSTRQHLHQMWHVRKLKLDQCFQLRLFEQDAEKMFDWISHNKELFLQSHTEIGVSY
QHALDLQTQHNHFAMNSMNAYVNINRIMSVASRLSEAGHYASQQIKQISTQLDQEWKSFA
AALDERSTILAMSAVFHQKAEQFLSGVDAWCKMCSEGGLPSEMQDLELAIHHHQSLYEQV
TQAYTEVSQDGKALLDVLQRPLSPGNSESLTATANYSKAVHQVLDVVHEVLHHQRRLESI
WQHRKVRLHQRLQLCVFQQDVQQVLDWIENHGEAFLSKHTGVGKSLHRARALQKRHDDFE
EVAQNTYTNADKLLEAAEQLAQTGECDPEEIYKAARHLEVRIQDFVRRVEQRKLLLDMSV
SFHTHTKELWTWMEDLQKEMLEDVCADSVDAVQELIKQFQQQQTATLDATLNVIKEGEDL
IQQLRSAPPSLGEPSEARDSAVSNNKTPHSSSISHIESVLQQLDDAQVQMEELFHERKIK
LDIFLQLRIFEQYTIEVTAELDAWNEDLLRQMNDFNTEDLTLAEQRLQRHTERKLAMNNM
TFEVIQQGQDLHQYIMEVQASGIELICEKDIDLAAQVQELLEFLHEKQHELELNAEQTHK
RLEQCLQLRHLQAEVKQVLGWIRNGESMLNASLVNASSLSEAEQLQREHEQFQLAIESLF
HATSLQKTHQSALQVQQKAEALLQAGHYDADAIRECAEKVALHWQQLMLKMEDRLKLVNA
SVAFYKTSEQVCSVLESLEQEYRRDEDWCGGRDKLGPAAEIDHVIPLISKHLEQKEAFLK
ACTLARRNAEVFLKYIHRNNVSMPSAASHTRGPEQQVKAILSELLQRENRVLHFWTLKKR
RLDQCQQYVVFERSAKQALDWIQETGEYYLSTHTSTGETTEETQELLKEYGEFRVPAKQT
KEKVKLLIQLADSFVEKGHIHATEIRKWVTTVDKHYRDFSLRMGKYRYSLEKALGVNTED
NKDLELDIIPASLSDREVKLRDANHEVNEEKRKSARKKEFIMAELLQTEKAYVRDLHECL
ETYLWEMTSGVEEIPPGILNKEHIIFGNIQEIYDFHNNIFLKELEKYEQLPEDVGHCFVT
WADKFQMYVTYCKNKPDSNQLILEHAGTFFDEIQQRHGLANSISSYLIKPVQRITKYQLL
LKELLTCCEEGKGELKEGLEVMLSVPKRANDAMHVSMLEGFDENLDVQGELILQDAFQVW
DPKSLIRKGRERHLFLFEISLVFSKEIKDSSGHTKYVYKNKLLTSELGVTEHVEGDPCKF
ALWSGRTPSSDNKTVLKASNIETKQEWIKNIREVIQERIIHLKGALKEPIQLPKTPAKQR
NNSKRDGVEDVDSQGDGSSQPDTISIASRTSQNTADSDKLSGGCELTVVLQDFNAGHSSE
LSIQVGQTVELLERPSERPGWCLVRTTERSPPQEGLVPSSALCISHSRSSVEMDCFFPLV
KGAFSKSSSESGSESESPVPLQAETSRNSLGSSCHPKRRLEFIQAWLASPYKRFNKKKGN
NPIGKWAKVKRRTKKRDLGSIPGWGRSPEGEHGNPHQQRGWACTDAEAEAPILWPPHAKR
KDHEPSPSKSSSSLLAARQASTEVPTAADLVSAIEQLVKSKLSLEGGSYRGSLKDPTGCL
NEGMTPPTPPRNLEEEQKAKALRGRMFVLNELVQTEKDYVKDLGIVVEGFMKRIEEKGVP
EDMRGKDKIVFGNIHQIYDWHKDVFLGELEKCIQEQDRLAQLFIKYERKLHIYVWYCQNK
PRSEYIVAEYDAYFEEVKQEINQRLTLSDFLIKPIQRITKYQLLLKDFLRYSEKAGLECS
DIEKAVELMCLVPKRCNDMMNLGRLQGFEGTLTAQGKLLQQDTFYVIELDAGMQSRTKER
RVFLFEQIVIFSELLRKGSLTPGYMFKRSIKMNYLVLEENVDNDPCKFALLNRETSERVI
LQAANADIQQAWVQDINQVLETQRDFLNALQSPIEYQRKERSTAVMRSQPARVPQASPRP
YSSIPVGSEKPPKGSSYNPPLPPLKISTSNGSPGFDYHQAGDKFEASKNDLGGCNGASSM
AVIKDYYALKENEICVSQGEVVQVLAVNQQNMCLVYQPASDHSPAAEGWVPGSILTPLTK
AMAATENSDGSIKKSCSWHTLRMRKRAEVENTGKNEATGPRKPKDILGNKVSVKETNSSE
ESECDDLDPNTSMEILNPNFIQEVAPEFLVPLVDVTCLLGDTVTLQCKVCGRPKPTITWK
GPDQNILDTDNSSATYTVSSCDSGEITLKICNLMPQDSGIYTCIAANDHGTASTSATVKV
QGVPAAPNRPIAQERSCTSVILRWLPPSSTGNCTISGYTVEYREEGSQAWQQSVASTLDT
YLVIEDLSPGSPYQFRVSASNPWGISLPSEPSEFVRLPDYDAAADGATISWKENFDSAYT
ELNEIGRGRFSIVKKCIHKATRKDVAVKFVSKKMKKKEQAAHEAALLQHLQHPQYITLHD
TYESPTSYILILELMDDGRLLDYLMNHDELMEEKVAFYIRDIMEALQYLHNCRVAHLDIK
PENLLIDLRIPVPRVKLIDLEDAVQISGHFHIHHLLGNPEFAAPEVIQGIPVSLGTDIWS
IGVLTYVMLSGVSPFLDESKEETCINVCRVDFSFPHEYFCGVSNAARDFINVILQEDFRR
RPTAATCLQHPWLQPHNGSYSKIPLDTSRLACFIERRKHQNDVRPIPNVKSYIVNRLNQG
T
Download sequence
Identical sequences F1MXJ6
ENSBTAP00000032241 ENSBTAP00000032241

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]