SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000032319 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000032319
Domain Number 1 Region: 169-285
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 9.15e-19
Family Ypt/Rab-GAP domain of gyp1p 0.0097
Further Details:      
 
Domain Number 2 Region: 329-441
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 0.00000000000236
Family Cell cycle control phosphatase, catalytic domain 0.051
Further Details:      
 
Domain Number 3 Region: 40-183
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.0000366
Family Ypt/Rab-GAP domain of gyp1p 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000032319   Gene: ENSBTAG00000015010   Transcript: ENSBTAT00000032386
Sequence length 700
Comment pep:known chromosome:UMD3.1:1:44199315:44254410:1 gene:ENSBTAG00000015010 transcript:ENSBTAT00000032386 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEGEEVLPLPTSGDEGWEKDLEEALEAGGCDLETLRNIIQGRPLPADLRAKVWKIALNV
AGKGDSLASWDGILDLPEQNTIHKDCLEFIDHLSVPEEKAAQLLLDIESVITFYCKSRNI
KYSSTLSWIHLLKPLVHLQLPRSDLYNCFYAIMNKYIPRDCSLKGRPFHLFRLLIQYHEP
ELCSFLDTKKITPDSYALNWLGSLFACYCSIEVTQAIWDGYLQQADPFFIYFLMLIILVN
AKEVILGQESDSKEEVIQFLENTPSSLNLEDIEDLFSLAQYYCSKTPASFRKDNHHLFGS
TLLGIKDDDADLSQALCLAISVSEILQANQLQGEGVRFFVVDCRPAEQYNAGHLSTAFHL
DSDLMLQNPSEFAQSVKSLLEAQKQSIESGSIAGGEHLCFMGSGREEEDMYMNMVLAHFL
QKNKEYVSIASGGFMALQQHLADINVDGPENGYGHWIASTSGSRSSINSSVDGESSNGSN
DRGMKSLVNKMTVALKTKSVNVREKVISFIENTSTPVDRMSFNLPWPDRTCTERHVSSSD
RVGKPYRGVKPVFSIGDEEEYDTDEIDSSSMSDDDRKEVVNIQTWINKPDVKHHFPCKEV
KESGHMFPSHLLVTATHMYCLREILSRKGLAYIQSRQALNSVVKITSKKKHPELITFKYG
NSSASGIEILAIERYLIPNAGDATKAIKQQIMKVLDALES
Download sequence
Identical sequences F1MU30
XP_005199900.2.59421 XP_005201278.1.76553 XP_006058790.1.26621 XP_010840249.1.44457 ENSBTAP00000032319 ENSBTAP00000032319

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]