SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000032342 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000032342
Domain Number 1 Region: 534-585
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000437
Family Classic zinc finger, C2H2 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000032342   Gene: ENSBTAG00000023675   Transcript: ENSBTAT00000032410
Sequence length 1086
Comment pep:known chromosome:UMD3.1:1:35660674:35743248:1 gene:ENSBTAG00000023675 transcript:ENSBTAT00000032410 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEEESDQEAERLGEELVAIVESPPGPAGLRAASDGRGGAGGGSCGGGGVGISSRDYCRR
FCQVVEDYAGRWQVPLPQLQVLQTALCCFTSASASFPDECEHVQYVLSSLALSFFELLLF
FGRDEFYEEPLKDILGSFQECQNHLRRYGNVNLELVTRIIRDGGPWEDPVLQAVLKAQPA
SQEIVNKYLSSENPLFFELRARYLIACERIPEAMALIKCCINHPEISKDLYFHQALFTCL
FMSPVEDHLFREHLLKTDCKSGIDIICNTEKEGKTMLALQLCESFLISQLQNGDMYCIWE
LIFIWSKLQLKSNPSKQVFVDQCYQLLRTATNVRVIFPFMKIIKDEVEEEGLQICVEICG
CALQLDLHDDPKTKCLIYKTIAHFLPNDLEILRICALSIFFLERSLEAYHTVEELYKRPD
EEYNEGTSSVQNRVRFELLPILKKGLFFDPEFWNFIMIKKNCVALLSDKSAVRFLNESAL
ENSAGNEGLDSLTDQSPGQLDPDDISGVQPKGPINAKKNLTALNASRVDHNVPRHRCMLC
NKEFLGGHIVRHAQAHQKKGSFSCVICGRKFRNRGLMQKHLKNHVKKIQRQQIAAAQQED
QENPALEEMNCSDTFISFENGNSDNKDLEVETITGSSDRNKDVIPAHPLPICVDDYEEEE
DEEGDYEEDDYDLNQESSVLHKINGAVCHPKDIYATDQEGNFKCPALGCVRIFKRIGFLN
KHARTVHPTDLNVRQTVMKWSKGKCKFCQRQFEDSQHFIDHLNRHSYPNVYFCLHFNCNE
SFKLPFQLAQHTKSHRIFQAQCSFPECHELFEDLPLLYEHEAQHYLSKTPESSAQPSEAI
LWDVLTDSKSNHQEKDSSGNERQTTSLPVSTSKSRKDITEPKTCIESMEKKTDSLIQNGN
EHSDDTVSDTSLTDQKMPDIEPNSENNCSINDLVNGHSGIEQTPLVSSDPALKIDTNRIR
TENGSILPSVVPQEHNTLPVSQAPSKPNPTSEHTSYGLILTKPYVRPLPPSYLDERYLSM
PKRRKFLTDRVDACSDQDNVCKKSVKRLRCGKCLTTYCNAEALEAHLAQKKCQTLFGFDS
DDESKS
Download sequence
Identical sequences F1MTV2
ENSBTAP00000032342 ENSBTAP00000032342

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]