SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000032579 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000032579
Domain Number 1 Region: 267-319
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000118
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 2 Region: 86-213
Classification Level Classification E-value
Superfamily SET domain 0.0000000000000474
Family Histone lysine methyltransferases 0.028
Further Details:      
 
Domain Number 3 Region: 246-275
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000976
Family Classic zinc finger, C2H2 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000032579   Gene: ENSBTAG00000023797   Transcript: ENSBTAT00000032650
Sequence length 363
Comment pep:known chromosome:UMD3.1:11:100972721:100988364:1 gene:ENSBTAG00000023797 transcript:ENSBTAT00000032650 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMGSVLPAEALVLKTGLKAPGLALAEVITSDILHSFLYGRWRNVLGEQLFEDKSHHASPK
TAFTAEVLAQSFSGATEVQKLSSLVLPAEVIIAQSSIPGEGLGIFSKTWIKAGTEMGPFT
GRVIAPEHVDICKNNNLMWEVFNEDGTVRYFIDASQEDHRSWMTYIKCARNEQEQNLEVV
QIGTSIFYKAIEMIPPDQELLVWYGNSHNTFLGIPGVPGLEEEQKKNKHEDFHPADSATG
TAGRMRCVICHRGFNSRSNLRSHMRIHTLDKPFVCRFCNRRFSQSSTLRNHVRLHTGERP
YKCQVCQSAYSQLAGLRAHQKSARHRPPSAALQAHSPALPAPHAHAPALAAAAAAHHLPA
MVL
Download sequence
Identical sequences E1B9X9
ENSBTAP00000032579 ENSBTAP00000032579 9913.ENSBTAP00000032579

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]