SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000032885 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000032885
Domain Number 1 Region: 142-194
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000143
Family Classic zinc finger, C2H2 0.0000968
Further Details:      
 
Domain Number 2 Region: 377-431
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000328
Family Classic zinc finger, C2H2 0.03
Further Details:      
 
Domain Number 3 Region: 196-224
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000795
Family Classic zinc finger, C2H2 0.0011
Further Details:      
 
Domain Number 4 Region: 286-312
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000118
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 5 Region: 440-464
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000153
Family Classic zinc finger, C2H2 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000032885   Gene: ENSBTAG00000003902   Transcript: ENSBTAT00000032958
Sequence length 567
Comment pep:known chromosome:UMD3.1:11:72067123:72097173:-1 gene:ENSBTAG00000003902 transcript:ENSBTAT00000032958 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSRLGAVPATPGPTPFKQQRSTRIVGAKNSRTQCSIKDNSFQYTIPHDDSLSGSSSASS
CEPVSDFPASFRKSTYWMKMRRIKSAAASHVEGPGGVSTKGKRKPRQEEDEDYREFPQKK
HKLYGRKQRPKAQPNPKAQTRRIRKEPPAYAAGSLEEQWYLEIVDKGSVSCPTCQAVGRK
TIEGLKKHMENCKQEMFTCHHCGKQLRSLAGMKYHVMANHNSLPILKAGDEIDEPSERER
LRTVLKRLGKLRCMRESCSSSFTSIMGYLYHVRKCGKGAAELEKMTLKCHHCGKPYRSKA
GLAYHLRSEHGPISFFPESGQPECLKDMSLESKSGGRVQRRSAKIAVYHLQELASAELAK
EWPKRKVLQDLVPDDRKLKYTRPGLPTFSQEVLHKWKSDIKKYHRIQCPNQGCEAVYSSV
SGLKAHLGSCTLGTFVAGKYKCLLCQKEFVSESGVKYHINSVHAEDWFVVNPTTTKSFEK
LMKIKQRQQEEEKRRQQHRSRRSLRRRQQPGIELPETEPSLRVGKDQRRNHEELLVATSR
KEPEQEPVPTQFQKVRSPKTNHKRGKK
Download sequence
Identical sequences A4FV61
ENSBTAP00000032885 NP_001076941.1.59421 NP_001076941.1.76553 XP_005895808.1.15283 XP_010838957.1.44457 XP_019826066.1.53367 ENSBTAP00000032885 9913.ENSBTAP00000032885

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]