SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000032920 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000032920
Domain Number 1 Region: 185-240
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.58e-20
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 2 Region: 245-291
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000157
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000032920
Domain Number - Region: 143-165
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0153
Family Classic zinc finger, C2H2 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000032920   Gene: ENSBTAG00000014749   Transcript: ENSBTAT00000032993
Sequence length 335
Comment pep:known chromosome:UMD3.1:1:121874133:121886919:1 gene:ENSBTAG00000014749 transcript:ENSBTAT00000032993 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSKTSLVMRKRIRLYRNALKEPSSSSGHHGPQLAAASSPSVFPGLHEQPPQASPSGTLN
GLLRLGLPGDMYARPEPFPPGPVSRSDALAAAAALHSYGGMNLTMNLAAPHGPGAFFRYM
RQPIKQELICKWLAADGPVPPRLCSKTFSTMHELVTHVTVEHVGGPEQANHICFWEECPR
QGKPFKAKYKLVNHIRVHTGEKPFPCPFPGCGKVFARSENLKIHKRTHTGEKPFRCEFEG
CERRFANSSDRKKHSHVHTSDKPYTCKVRGCDKCYTHPSSLRKHMKVHGRSPPPPSSGYD
SATPSALVSPSSDFGREPPVASSAAVAARGADLSE
Download sequence
Identical sequences E1BAQ8
ENSBTAP00000032920 ENSBTAP00000032920 XP_002685060.4.76553 XP_015317605.1.59421 XP_015328636.1.76553 XP_586391.7.59421 9913.ENSBTAP00000032920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]