SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000033274 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000033274
Domain Number 1 Region: 104-160
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.51e-22
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 2 Region: 248-300
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.46e-20
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 3 Region: 145-197
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000166
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000033274   Gene: ENSBTAG00000007983   Transcript: ENSBTAT00000033361
Sequence length 301
Comment pep:known chromosome:UMD3.1:4:113629209:113630153:1 gene:ENSBTAG00000007983 transcript:ENSBTAT00000033361 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GDGLVMKIKQEKPEWLLQTQAALSQKDKENIFRPRRVPPPCQTAAGKSQAWGHPDGTGGP
RWAPPSEQAVGRAGRAPRAASGPLSPALPAGEGHFVCPDCGKRFSWWSSLKIHQRTHTGE
KPYPCGKCGKSFSQKPNLARHQRHHTGERPFCCPECARRFSQKQHLLKHQKTHSRPATHP
CPECARCFRHQVGLRIHQRAHARXRQGPRAGPPGSAPAAGAPEGAPRVGLAGWWRPPGAR
PAAPGEPRQFICNECGKSFTWWSSLNIHQRIHTGERPYPCPECGRRFSQKPNLTRHLRNH
T
Download sequence
Identical sequences F1N5Z6
ENSBTAP00000033274 ENSBTAP00000033274

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]