SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000033320 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000033320
Domain Number 1 Region: 544-590
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000262
Family TSP-1 type 1 repeat 0.00093
Further Details:      
 
Domain Number 2 Region: 123-164
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000956
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 3 Region: 63-111
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000902
Family TSP-1 type 1 repeat 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000033320   Gene: ENSBTAG00000003775   Transcript: ENSBTAT00000033407
Sequence length 590
Comment pep:known chromosome:UMD3.1:3:89742861:89786323:1 gene:ENSBTAG00000003775 transcript:ENSBTAT00000033407 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTSRTWAWRVPAELFLLCAALGSFSVPSSRGERPPSLGSNAVNESLAKTRQTRSVDVTP
LPIDCELSSWSSWTTCDPCQKKRYRHAYLIRPSQFHGEQCNFSDKEVEDCVSNRPCRSQV
RCEGFVCAQTGRCINRRLLCNGDNDCGDQSDEANCRKTYKKCQQEMEQYWAIGSLASGIN
LFTNNLEGPVLDHRYYAGLCSPHYILNTRFRKPYNVENFIPQTRGKYDFTLTEYESYSDF
EHNVTGTAISRSSFSLGFKIAGIFELGYSSMSNIGQHFISRIRRFSHTKSKFLHARSDLE
VAHYKLKTRNLMLHHEFLQRVKQLPLEYSYGEYRDLFRDFGTHYITEAVLGGIYEYTLIM
NKEAMDRGDYSLKNIHDCAKHDFKIGAAITSVYLKLGVSEAKCSDILNEIKDRNKKDSMV
KDLVVLVRGGASEYVTALAYKELPTADLMQEWGDAVQYNPDIIKVKVMPLYELVTATDFA
YSSTVKQNMKKALEEFQKEVDSCQCAPCQGNGVPVLKGTRCECICPAGFQGSACEVTHRK
NVPIDGKWNCWSNWSPCSGGHKTRQRQCTNPPPGNGGNPCSGPASETLNC
Download sequence
Identical sequences F1N102
NP_001039606.3.59421 NP_001039606.3.76553 ENSBTAP00000033320 ENSBTAP00000033320

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]