SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000033519 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000033519
Domain Number 1 Region: 410-470
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.13e-18
Family Classic zinc finger, C2H2 0.0017
Further Details:      
 
Domain Number 2 Region: 457-512
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000023
Family Classic zinc finger, C2H2 0.0021
Further Details:      
 
Domain Number 3 Region: 363-392
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000061
Family Classic zinc finger, C2H2 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000033519   Gene: ENSBTAG00000010671   Transcript: ENSBTAT00000033607
Sequence length 1470
Comment pep:known chromosome:UMD3.1:4:79444243:79758476:1 gene:ENSBTAG00000010671 transcript:ENSBTAT00000033607 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPHYHPPHLFPAFHPPVPIDARHHEGRYHYDPSPIPPLHVPSALSSSPTYSDLPFIRIS
PHRNPAAASESPFSPPHPYINPYMDYIRSLHSSPSLSMISAARGLSPTDAPHAGVSPAEY
YHQMALLAGQRSPYADIIPSAATAGAGAIHMEYLHAMDSTRFPSPRLSARPSRKRTLSIS
PLSDHSFDLQTMIRTSPNSLVTILNNSRSSSSASGSYGHLSASAISPALSFTYPSAPVSL
HMHQQILSRQQSLGSAFGHSPPLIHPAPTFPTQRPIPGIPTVLNPVQVSSGPSESSQNKP
TSESAVSSTGDLVHNKRSKIKPDEDLPSPGPRGQQEQPEGTTLVKEEGDKDESKQEPEVI
YETNCHWEGCSREFDTQEQLVHHINNDHIHGEKKEFVCRWLDCSREQKPFKAQYMLVVHM
RRHTGEKPHKCTFEGCTKAYSRLENLKTHLRSHTGEKPYVCEHEGCNKAFSNASDRAKHQ
NRTHSNEKPYVCKIPGCTKRYTDPSSLRKHVKTVHGPEAHVTKKQRGDVHPRPPPPRDSG
SHSQSRSPGRQTQGALGEQKDLSNTTSKREECLQVKTVKAEKPMTSQPSPGGQSSCSSQQ
SPISNYSNSGLELPLTDGGGVGDLSAIDETPIMDSTISTATTALALQARRNPAGTKWMEH
VKLERLKQVNGMLPRLNPILPPKAPAVSPLIGNGTQPSTSCSLGGPMPLLPNRSDLSGVD
ITMLNMLNRRDSSTSTVSSAYLSSRRSSGISPCFSSRRSSEASQAEGRPQNVSVADSYDP
ISTDASRRSSEASQGDGLPSLLSLTPAQQYRLKAKYAAATGGPPPTPLPNMERMSLKTRM
ALLGDGREPAGTLPPVHPPRRCSDGGAHGYSRRPLLPQDALGNGVRRASDPVRTVSESLS
LPRVQRFNSLNSFNPPVLPPSLEKRNLVLQNYTRPDGGQARHFHSSPCPPSITENVTLES
LTMDADVSLNDEDLLPDDVVQYLNSQNPAGYEQHFPGTFSDDSKVPHGLGSGPGDFDPLG
LPDSHASHTGSQQYRSLEQPCPDASKSDLPIQWNEVSSGSADLSSSKLKCGQRSMGQQAR
AFGSYSHMGVHPQNPLRSGAGPAGGYPTLGEHASSFGGPEHLVSHGGGAGTNGNAFHEPP
YKAQQYGNCLNRQPGAPTLLDGACGPGIQAAKLKSITMQGSGSHLDFGLSVVPNESTGST
VNGIPTPDPTGQGYLAQQLLGDSTHTQGAGRSGQNLLGQASATSHIYQGPESSLPGPPSI
SVQPPNVAAVRGYQPCVGYGGSRRQAGPRGGLALQPGQFSDPSQTCRVNGIKMEMPGQPH
QLCSNVQSYSGQFYDQTVGFGQQDMKTGSFSMSEANCLLQGAGAENSELLSPGANQVTST
VDSLDSHDLEGVQIDFDAIIDDGDHASLMSGALSPSIIQNLSHSSSRLTTPRAALPFPPL
SLSTTNMAIGDMSSLLTSLAEESKFLAVMQ
Download sequence
Identical sequences F1N215
9913.ENSBTAP00000033519 ENSBTAP00000033519 ENSBTAP00000033519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]