SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000033720 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000033720
Domain Number 1 Region: 1134-1155,1194-1221
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000108
Family C2HC finger 0.062
Further Details:      
 
Domain Number 2 Region: 703-743
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000742
Family Classic zinc finger, C2H2 0.033
Further Details:      
 
Domain Number 3 Region: 822-873
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000227
Family Classic zinc finger, C2H2 0.025
Further Details:      
 
Domain Number 4 Region: 761-809
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000411
Family Classic zinc finger, C2H2 0.043
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000033720
Domain Number - Region: 961-1011
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000166
Family Classic zinc finger, C2H2 0.038
Further Details:      
 
Domain Number - Region: 531-571
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00385
Family Classic zinc finger, C2H2 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000033720   Gene: ENSBTAG00000007318   Transcript: ENSBTAT00000033811
Sequence length 1236
Comment pep:known chromosome:UMD3.1:3:19552536:19557450:-1 gene:ENSBTAG00000007318 transcript:ENSBTAT00000033811 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDMKTPDFDDLLAAFDIPDIDANEAIHSGPEENEGPGGSGKPEPSVGGESGEATAAPAG
DGPGGPTQASDHSLPPPDVSAVSVIVKNTVCPEQSESLAGSSGGEGARAGGVTKEGPLGP
RLMQNGFGGPEPSLPGTPRSPAPPSGGTWKEKSLEGKAPLDLFAHFGPEPGEHPDPLPPS
APSPPREGALTPPAFPSPFELTRENGPALLPPSSPPLLGTLKQESCSPLHPQSLAQPGSG
TSPEATGVPASASPSQVAGVSFFKKSPGHQSPLASPKGPSCQPLKEEEDEGPVDKSSPGS
PQSPSSGAEAADEDSNDSPASSSSRPLKVRIKTIKTSCGNITRTVTRVPSDPDPPAPLAE
GGFLAEANLLKLSPATPTPEGPKVVSVQLGDGTRLKGTVLPVATIQNASTAMLMAASVAR
KAVVLPGGTATSPKTMPKNVLGLVPQALPKAEGRTGLGTGGQKVNGASVVMVQPSKPATG
PGAAGGTVISRTQSSLVEAFNKILNSKNLLPAYRPNLSPPAEAGLALPPTGYRCLECGDA
FSLEKSLARHYDRRSMRIEVTCNHCARRLVFFNKCSLLLHAREHKDKGLVMQCSHLVMRP
VALDQMVGQPDITPLLAVPPALGPPALPALGKGEGAVTTSAITAVAAEAPVLPLSTEPPA
TPATSTYTCFRCLECKEQCRDKAGMAAHFQQLGPPAPGATSNVCPTCPMMLPNRCSFSAH
QRMHKNRPPHVCPECGGNFLQANFQTHLREACLHFSRRVGYRCPSCAVVFGGVNSIKSHI
QTSHCEVFHKCPICPMAFKSAPSAHAHLYTQHPSFHTQQAKMIYKCAMCDTVFTHKPLLS
SHFDQHLLPQRVSVFKCPSCPLLFAQKRTMLEHLKNTHQSGRPGEETAGKGAGGALLTPK
TEPEELAVSRAGTAAPTEESSSTSEEEEPPSSPEPPRPTKRPRRELGSKGMKGGGGGPGG
WTCGLCHSWFPERDEYVGHMKKEHGKSVKKFPCRLCERSFCSAPSLRRHVRVNHEGIKRV
YPCRYCTEGKRTFSSRLILEKHVQVRHGLPLGAQSPGRGSALARGPGARAQGPGRKRRQS
SDSCSEEPDSTTPPAKSPRGAPGSGGHGPLRYRGGGSAEQSLMVGLRVDGGAQQCLDCGL
CFASPGSLSRHRFISHKKKRGVGSASALGLGDGEEEAPPPSRSDPDGGESPLPASGGPLT
CKVCGKSCDSPLNLKTHFRTHGMAFIRARQGGSGDN
Download sequence
Identical sequences E1BQ01
ENSBTAP00000033720 NP_001192386.1.59421 NP_001192386.1.76553 XP_005204009.2.76553 XP_005204011.1.76553 ENSBTAP00000033720 9913.ENSBTAP00000033720

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]