SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000033892 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSBTAP00000033892
Domain Number - Region: 54-102
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.000837
Family Ypt/Rab-GAP domain of gyp1p 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000033892   Gene: ENSBTAG00000024482   Transcript: ENSBTAT00000033990
Sequence length 370
Comment pep:known chromosome:UMD3.1:16:57525193:57682376:1 gene:ENSBTAG00000024482 transcript:ENSBTAT00000033990 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEGVPCPAPAAKLTAPVKKSQDMHDERSKLVNEYACRVLELLGMGHRLFVPRLLATSKE
DLLQADFEGALKFFRVQLPKRYRAEENARRLMEQACNIKVPTKKLKKYEKEYQTMRESQL
QQEDPMDRYKRENRRLQEASMRLEQENDDLAHELVTSKIALRNDLDQAEDKADVLNKELL
LTKQRLVETEEEKRKQEEETAQLKEVFRKQLEKAEYEIKKTTAIIAEYKQICSQLSTRLE
KQQAASKEELEVVKGKMMACKHCSDIFSKEGALKAAAVSREDQGIESDDEKDSLKKQLRE
MELELAQTKLQLVEAKCKIQELEHQRGALMNEIQAAKNSWFSKTLNSIKTATGTQPLQPP
QATQPPKEST
Download sequence
Identical sequences A7YY30
ENSBTAP00000033892 ENSBTAP00000033892 XP_003583303.1.59421 XP_003587136.1.76553 XP_005890889.1.15283 XP_019831789.1.53367 9913.ENSBTAP00000033892

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]