SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000034226 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000034226
Domain Number 1 Region: 59-119
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.44e-26
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 2 Region: 506-563
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.41e-24
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 3 Region: 366-423
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.2e-23
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 4 Region: 282-339
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.56e-21
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 5 Region: 422-479
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.37e-21
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 6 Region: 576-628
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.6e-20
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 7 Region: 244-296
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.35e-18
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 8 Region: 329-361
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000104
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 9 Region: 469-500
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000135
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000034226   Gene: ENSBTAG00000008349   Transcript: ENSBTAT00000034329
Sequence length 666
Comment pep:known chromosome:UMD3.1:23:29860782:29868157:1 gene:ENSBTAG00000008349 transcript:ENSBTAT00000034329 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KRKNVSSELSGGRPTSLLGLRETKLISLLSALPFPQCPALARDGSQGNLPGAKHTVMSQP
QESVTFEDVAVNFSHEEWQCLTHAQRHLYKDVMLENYGNMVSLGFSFSKPPLISHLEQGT
EPYVQDRQDWEFLSCSYPVSAAKTWPESEKARSEQEVFENGEVCWVKFKSLLKVVSQDPE
VGEVCVQDVKLENQWEMPVREKWREEKESCDKVTFRKGKNQKGLIKHFSPNSECILYGVL
TEKKQHECTRCGKNFSWHSDLILHERIHSGEKPYVCNECGKAFKTKNQLSMHQIIHTGEK
PFNCTQCGKAFSSRSALCRHKKTHSGEKPHPCSDCGKAFKTRYCLRMHQIIHTGEKPYEC
SDCGKAFQFKHSLIIHSRSHTGEKPYACEECGKAFSGSSDLIKHTRVHTGERPYECNECG
RAFSWSSDLSKHRRLHTQEKHCECPQCGKAFSNEAELTKHRRIHTKEKPYKCKECGKTFH
HNCKCRAHERGHTGEKPHRCGDCGKTFQDQHCLTIHQRIHTGEKPYKCSDCGRAFSGKSN
LTNHQRIHTGEKPYRCEVCGKVFHQSSVLRQHERIHTGEKPFTCHECGTSFRQSSALIGH
KRVHTGEKPYICEECGKAFRVSSNLTRHKKRKHRVWETHKRGESGKSLHNSTVILHTSML
QILTAD
Download sequence
Identical sequences F1MPI9
ENSBTAP00000034226 ENSBTAP00000034226

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]