SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000034705 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000034705
Domain Number 1 Region: 336-650
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 3.14e-121
Family Mammalian PLC 0.0000000236
Further Details:      
 
Domain Number 2 Region: 177-332
Classification Level Classification E-value
Superfamily EF-hand 2.45e-44
Family EF-hand modules in multidomain proteins 0.00026
Further Details:      
 
Domain Number 3 Region: 656-781
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.57e-30
Family PLC-like (P variant) 0.00014
Further Details:      
 
Domain Number 4 Region: 55-165
Classification Level Classification E-value
Superfamily PH domain-like 1.13e-20
Family Pleckstrin-homology domain (PH domain) 0.0000832
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000034705   Gene: ENSBTAG00000006052   Transcript: ENSBTAT00000034821
Sequence length 815
Comment pep:known chromosome:UMD3.1:19:45411512:45432420:-1 gene:ENSBTAG00000006052 transcript:ENSBTAT00000034821 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLCGSWRSRRRQPEEPLVPAQVATPVGLASPPASQEGNIKRPGLRALKKMGLSEDEDVRA
MLRGSRFCKIRSPTWQKERLYRLQEDGLSVWFQRRIPRAPSQHIFFVQHIEAIREGHQSE
GLRHFGGAFEPARCLTIAFKGRRKNLDLVAPTAEEAQRWVRGLAKLRARLDAMSQRERLD
HWIHSYLHRADSNQDSKMSFKEIKNLLRMVNLDMNDMYAYGLFKECDRSKNERLEGPEIE
EFLRRLLKRPELEEIFHRYSGEDRVLSASELLEFLEDQGEHKATLAHAQQLIHTYELNET
AKQHELMTLDGFMMYLLSPEGAALDLAHTRVFQDMDQPLAHYFISSSHNTYLTDSQIGGP
SSTEAYVRAFAQGCRCVELDCWEGPGGEPVIYHGHTLTSKILFRDVIQAVREHAFTVSPY
PVILSLENHCGLEQQAAMARHLHTILGDMLVTQTLDSQNPEELPSPERLKGRVLVKGKKL
PDTRSENGCILSEREEEDEEEDEEEELGAVEQRRRAKQISPELSALAVYCCATRLRTLRP
PPVPPQPCQVSSLSERKAKKLIREAGNSFVRHNARHLTRVYPLGLRMNSANYSPQEMWNS
GCQLVALNFQTPGYEMDLNAGRFLVNGQCGYILKPVRLRSPNTTFDPECPGPPRTTLTIQ
VLTAQQLPKLNTEKPNSIVDPLVRIEIHGVPADCARKKTNYVLNNGFNPRWGQTLEFQLR
VPELALVRFVVEDYDATSPNDFVGQFTLPLSSLKQGYRHIHLLSKDGASLSPATLFVHIC
IRSRATLGSAGASLCPTPALRSGGRDGGPAPPSSR
Download sequence
Identical sequences E1BJE0
ENSBTAP00000034705 NP_001179957.1.59421 NP_001179957.1.76553 ENSBTAP00000034705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]