SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000035023 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000035023
Domain Number 1 Region: 3-64
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.31e-27
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 2 Region: 331-388
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.69e-27
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 3 Region: 471-528
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.67e-26
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 4 Region: 275-332
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.86e-24
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 5 Region: 387-444
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.95e-23
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 6 Region: 515-575
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.69e-23
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 7 Region: 564-598
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000364
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 8 Region: 434-466
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000597
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000035023
Domain Number - Region: 220-276
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000345
Family Classic zinc finger, C2H2 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000035023   Gene: ENSBTAG00000025124   Transcript: ENSBTAT00000035145
Sequence length 602
Comment pep:known chromosome:UMD3.1:7:64233853:64237033:-1 gene:ENSBTAG00000025124 transcript:ENSBTAT00000035145 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ILLLQGLVSFKDVAVDFTQEEWQQLDSAQKTLYRDVMLENYSHLVSMGHPVSKPDVISKL
EQGEDPWIIKRDIPNWICPYEGQADGRLDRKSNLDNPQSCILGSVSFHNKILKGVIKDGS
LYSILKVCQSDGQLQRCQKNRLSRQVTVINNKTMTVESDYRYDALRKIFKECIESDASRN
RPYNYDSFKKNSKSNIDLPSCNKNNSRTNLDESFECGKSFIHNVANSNLEKLHNGVIPCN
DNEHGNIFSKKQSIILYQNVDTKEKTCVCITCGKAFAKKSQLIVHQRIHTGKKPYDCGAC
GKAFSEKFHLIVHQRTHTGEKPYECSECGKAFSQKSSLIIHQRVHTGEKPYECSECGKAF
SQKSPLIIHQRIHTGEKPYECRECGKAFSQKSQLIIHHRAHTGEKPYECTECGKAFCEKS
HLIIHKRIHTGEKPYKCAQCEEAFSRKTELITHQLIHTGEKPYECTACGKTFSRKSQLII
HQRTHTGEKPYKCNECGKAFCQKSHLIGHQRIHTGEKPFVCTECGKAFSQKSHLPGHQRI
HTGEKPYVCAECGKAFSQKSDLVLHRRIHTGERPYRCAVCGKAFIQKSQLTVHQRIHSSG
KN
Download sequence
Identical sequences F1N0Y6
ENSBTAP00000035023 ENSBTAP00000035023 9913.ENSBTAP00000035023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]