SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000035289 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000035289
Domain Number 1 Region: 402-457
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.23e-20
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 2 Region: 445-499
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000914
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000035289   Gene: ENSBTAG00000025246   Transcript: ENSBTAT00000035414
Sequence length 614
Comment pep:known chromosome:UMD3.1:12:80718632:80724166:1 gene:ENSBTAG00000025246 transcript:ENSBTAT00000035414 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLWRRRRLLLRFLSAPSLRVRPPEAHPGGGGGGGRRSAARGTEAAATTAAAACAWSRAAA
GRSPASGAGVGAEEARGSSGPAGRAGTLAMLLDAGPQFPAIGVGSFARHHHHSAAAAAAA
AAEMQDRELSLAAAQNGFVDSAAAHMGAFKLNPGAHELSPGQSSAFTSQGPGAYPGSAAA
AAAAAALGPHAAHVGSYSGPPFNSTRDFLFRSRGFGDSAPGGGQHGLFGPGAGGLHHAHS
DAQGHLLFPGLPEQHGPHGSQNVLNGQMRLGLPGEVFGRSEQYRQVASPRTDPYSAAQLH
NQYGPMNMNMGMNMAAAAAHHHHHHHHPGAFFRYMRQQCIKQELICKWIDPEQLSNPKKS
CNKTFSTMHELVTHVSVEHVGGPEQSNHVCFWEECPREGKPFKAKYKLVNHIRVHTGEKP
FPCPFPGCGKVFARSENLKIHKRTHTGEKPFQCEFEGCDRRFANSSDRKKHMHVHTSDKP
YLCKMCDKSYTHPSSLRKHMKVHESSPHVSESSPAASSGYESSTPPGLVSPSAEPQSSST
LSPAAAAAAAAAAAAAAVSAVHRSGGAGGSSGGGGGGGGGGGAGGGGGGGSSGGGSGTAG
GHGGLSSNFNEWYV
Download sequence
Identical sequences F1N0D7
ENSBTAP00000035289 ENSBTAP00000035289

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]