SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000035458 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000035458
Domain Number 1 Region: 45-135
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 2.38e-36
Family SCAN domain 0.0000585
Further Details:      
 
Domain Number 2 Region: 319-376
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.75e-21
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 3 Region: 375-432
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.51e-19
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 4 Region: 421-473
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.61e-18
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 5 Region: 281-333
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.52e-17
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 6 Region: 217-266
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000224
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000035458   Gene: ENSBTAG00000031869   Transcript: ENSBTAT00000035587
Sequence length 479
Comment pep:known chromosome:UMD3.1:23:30161123:30171348:-1 gene:ENSBTAG00000031869 transcript:ENSBTAT00000035587 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAIAWGTVPSLAPVNLKKEGLQVVKEDHLSAREQGVKLQGNGTGFRQEPLCKRFRQLRYE
ETTGPREALSRLRELCRQWLQPETHTKEQILELLVLEQFLTILPEELQARLREHHLESGE
DAVVFLEDLQLELGGTGQQEDPNQAKKQEVLMEKTAPGKATPERQVQPEGDVPQPEREKG
EAKRIENGKLVVETDSCGRVESSGKPFEPMEVHYKDSNLDRQQAEPKEKTDCKCSEYGQA
FFQHSDLIKHESSHRKEKLCEAEVCQSLSLPGHQKICSREKGHQCHECGKAFQRSSHLVR
HQKIHLGEKPYQCKECGKVFSQNAGLLEHLRIHTGEKPYLCIHCGKNFRRSSHLNRHQRI
HSQEEPCQCKECGKTFSQALLLTHHQRIHSHSRSHQCNECGKTFSLTSDLIRHHRIHTGE
KPFKCTICQKAFRLNSHLAQHVRIHNEEKPYKCNECGEAFRQRSGLFQHQRYHHKNRLA
Download sequence
Identical sequences F1MZE1
9913.ENSBTAP00000035458 ENSBTAP00000035458 XP_005223776.1.76553 XP_005223777.1.76553 XP_005223778.1.76553 XP_010816730.1.76553 XP_015315423.1.76553 XP_015315424.1.76553 ENSBTAP00000035458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]