SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000035656 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000035656
Domain Number 1 Region: 48-87
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000833
Family HkH motif-containing C2H2 finger 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000035656   Gene: ENSBTAG00000025452   Transcript: ENSBTAT00000035788
Sequence length 411
Comment pep:known chromosome:UMD3.1:7:22687237:22695545:1 gene:ENSBTAG00000025452 transcript:ENSBTAT00000035788 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFQHRPGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCL
TLHNNEGSYLAHTQGKKHQTNLARRAAKEAKEAPAQPAPEKVKVEVKKFVKIGRPGYKVT
KQRDTEMGQQSLLFQIDYPEIAEGIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYETIA
FKVPSREIDKAEGKFWTHWNRETKQFFLQFHFKMEKPPAPPSLPAGPPGVKRPPPPLMNG
LPPRPPLPESLPPPPPGGLPLPPMPPSGPAPSGPPGPPQLPPPAPGVHPPAPVVHPPASG
VHPPAPGVHPPAPGVHPPAPVVHPPASGVHPPAPGVHPPAPGVHPPAPGVHPPAPGVHPP
PSAGVHPQAPVVHPPAPAVHPQAPGVHPTPAVHPQAPGVHPPAPGVHPPAP
Download sequence
Identical sequences G3MW14
ENSBTAP00000035656 ENSBTAP00000035656

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]