SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000035666 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000035666
Domain Number 1 Region: 304-370
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.88e-17
Family PHD domain 0.0046
Further Details:      
 
Domain Number 2 Region: 256-317
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000354
Family PHD domain 0.034
Further Details:      
 
Domain Number 3 Region: 193-222
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000013
Family Classic zinc finger, C2H2 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000035666   Gene: ENSBTAG00000025458   Transcript: ENSBTAT00000035798
Sequence length 378
Comment pep:known chromosome:UMD3.1:10:84501207:84668808:-1 gene:ENSBTAG00000025458 transcript:ENSBTAT00000035798 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KLNVLADPMQKLGDQFYKEAIEHCRSYNSRLCAERSVRLPFLDSQTGVAQNNCYIWMEKR
HRGPGLAPGQLYTYPARCWRKKRRLHPPEDPKLRLLEIKPEVELPLKKDGFTSESTTLEA
LLRGEGVEKKVDAREEENIQEIQRVLENDENVEEGNEEEDLEEDIPKRKNRTRGRARGSA
GGRRRHDAASQEDHDKPYVCDICGKRYKNRPGLSYHYAHTHLASEEGDEAQDQETRSPPN
HRNENHRPQKGPDGTVIPNNYCDFCLGGSNMNKKSGRPEELVSCADCGRSGHPTCLQFTL
NMTEAVKTYKWQCIECKSCILCGTSENDDQLLFCDDCDRGYHMYCLNPPVAEPPEGSWSC
HLCWELLKEKASAFGCQA
Download sequence
Identical sequences F1N0V2
ENSBTAP00000035666 ENSBTAP00000035666 9913.ENSBTAP00000035666

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]