SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000035721 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000035721
Domain Number 1 Region: 67-125
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.07e-17
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 2 Region: 114-149
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000055
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 3 Region: 465-514
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000161
Family Classic zinc finger, C2H2 0.047
Further Details:      
 
Domain Number 4 Region: 190-216
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000446
Family Classic zinc finger, C2H2 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000035721   Gene: ENSBTAG00000037804   Transcript: ENSBTAT00000035854
Sequence length 522
Comment pep:known chromosome:UMD3.1:2:101562584:101706119:-1 gene:ENSBTAG00000037804 transcript:ENSBTAT00000035854 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSTNSVKLEMQSDEECDRKPLSREDEIRGHDEGSSLEEPLIESSEVADNRKVQELQGEG
GIRLPNGKLKCDVCGMVCIGPNVLMVHKRSHTGERPFHCNQCGASFTQKGNLLRHIKLHS
GEKPFKCPFCSYACRRRDALTGHLRTHSGIIPHVEMVYKENVNMMRTVVSYNADILYYNS
KDVSPERMGKPHKCNYCGRSYKQRSSLEEHKERCHNYLQNVSMEAAGQVMSHHVPPMEDC
KEQEPIMDNNISLVPFERPAVIEKLTGNMGKRKSSTPQKFVGEKIMRFSYPDIHFDMNLT
YEKEAELMQSHMMDQAINNAITYLGAEALHPLMQHPPSTIAEVAPVISSAYSQVYHPNRI
ERPISRETSDSHENNMDGPISLIRPKSRPQEREASPSNSCLDSTDSESSHDDHQSYQGNP
ALNPKRKQSPAYMKEDVKALDTTKAPKGSLKDIYKVFNGEGEQIRAFKCEHCRVLFLDHV
MYTIHMGCHGYRDPLECNICGYRSQDRYEFSSHIVRGEHTFH
Download sequence
Identical sequences G3X7L0
ENSBTAP00000034255 ENSBTAP00000035721

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]