SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000035733 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000035733
Domain Number 1 Region: 11-128
Classification Level Classification E-value
Superfamily POZ domain 5.89e-33
Family BTB/POZ domain 0.00042
Further Details:      
 
Domain Number 2 Region: 395-446
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.14e-19
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 3 Region: 431-483
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.47e-17
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000035733   Gene: ENSBTAG00000020117   Transcript: ENSBTAT00000035866
Sequence length 579
Comment pep:known chromosome:UMD3.1:7:21189879:21196263:1 gene:ENSBTAG00000020117 transcript:ENSBTAT00000035866 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGGVDGPIGIPFPDHSSEILSGLNEQRTQGLLCDVVILVEGREFPTHRSVLAACSQYFK
KLFTSGAVVDQQNVYEIDFVSAEALTALMDFAYTATLTVSTANVGDILSAARLLEIPAVS
HVCADLLDRQILAADAGADAGQLDLVDQIDQRNLLRAKEYLEFFQTNPMNSLPATAAASF
PWSTFGASDDDLDATKEAVAAAVAAVAAGDCNGLDFYGPGPPAERPPAGDGDEGDSNPGL
WPERDEDAPAGGLFPTPVVPPSTATQNGHYGRGGEEEAASLSEAAPEPGDSPGFLSGAAE
GEDADGADADGLAASTLLQQMMSSVGRAGATTAGDSDEESRADDKGVVDYYLKYFSGAHD
GDVYPAWSQKVEKKIRAKAFQKCPICEKVIQGAGKLPRHIRTHTGEKPYECNICKVRFTR
QDKLKVHMRKHTGEKPYLCQQCGAAFAHNYDLKNHMRVHTGLRPYQCDSCCKTFVRSDHL
HRHLKKDGCNGVPSRRGRKPRVXAPPPPGAPAPPGSPEDDTATAARRNGQEKHFKDEDEE
EDEASPDGLGRLNVASAAGGGDGGSRATTADGSFAAGLA
Download sequence
Identical sequences E1BIJ8
ENSBTAP00000035733 ENSBTAP00000035733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]