SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000036117 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000036117
Domain Number 1 Region: 530-921
Classification Level Classification E-value
Superfamily Ribonuclease H-like 9.1e-31
Family Hermes transposase-like 0.0013
Further Details:      
 
Domain Number 2 Region: 425-503
Classification Level Classification E-value
Superfamily Hermes dimerisation domain 8.37e-21
Family Hermes dimerisation domain 0.0064
Further Details:      
 
Domain Number 3 Region: 225-247,356-383
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000106
Family Classic zinc finger, C2H2 0.032
Further Details:      
 
Domain Number 4 Region: 116-179
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000266
Family Classic zinc finger, C2H2 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000036117   Gene: ENSBTAG00000025659   Transcript: ENSBTAT00000036255
Sequence length 923
Comment pep:known chromosome:UMD3.1:8:104797238:104995986:1 gene:ENSBTAG00000025659 transcript:ENSBTAT00000036255 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNQPGGAAAPQADGASAAGRKSAASRERLKRSQKSNKLEGPEPVPAEASLSTEQGTMTEV
KVKTELPDDYIQEVIWQGEAKEEKKAVSKDGTTGDVPAEICVVIGGVRNQQTLGSYECGI
CGKKYKYYNCFQTHVRAHRDTEATSGEGASQGNNFRYTCDICGKKYKYYSCFQEHRDLHA
VDVFSVEGAPENRADPFDQGVVATDEVKEEPPEPFQKIGPKTGNYTCEFCGKQYKYYTPY
QEHVALHAPISTAPGWEPPDDPDTGSECSHPEVSPSPRFVAAKTQTNQSGKKAPASVVRC
STLLHRTPPATQTQTFRTPNSGSPASKATAESAFSRRVEGKAQNHFEETNSSSQNSSAEP
YTCGACGIQFQFYNNLLEHMQSHAADNENNIASNQSRSPPAVVEEKWKAQAQRNSANNTT
TSGLTPNSMIPEKERQNIAERLLRVMCADLGALSVVSGKEFLKLAQTLVDSGARYGAFSV
TEILGNFNTLALKHLPRMYNQVKVKVTCALGSNACLGIGVTCHSQSVGPDSCYILTAYQA
EGNHIKSYVLGVKGADIRDSGDLVHHWVQNVLSEFVMSEIRTVYVTDCRVSASAFSKAGM
CLRCSACALNSVVQSVLSKRTLQARSMHEVIELLNVCEDLAGSTGLAKETFGSLEETSPP
PCWNSVTDSLLLVHERYEQICEFYSRAKKMNLIQSLNKHLLSNLAAILTPVKQAVIELSN
ESQPTLQLVLPTYVRLEKLFTAKANDAGTVSKLCHLFLEALKENFKVHPAHKVAMILDPQ
QKLRPVPPYQHEEIIGKVCELINEVKESWTEEADFEPAAKKPRSAPGENPATQEDDRLGK
NEVYDYLQEPLFQATPDLFQYWSCVTQKHTKLARLAFWLLAVPAVGARSGCVNMCEQALL
IKRRRLLSPEDMNKLMFLKSNML
Download sequence
Identical sequences E1BJV7
ENSBTAP00000036117 ENSBTAP00000036117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]