SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000037091 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000037091
Domain Number 1 Region: 25-164
Classification Level Classification E-value
Superfamily EF-hand 4.33e-42
Family Calmodulin-like 0.0000381
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000037091   Gene: ENSBTAG00000026266   Transcript: ENSBTAT00000037254
Sequence length 171
Comment pep:known chromosome:UMD3.1:24:37834593:37910130:1 gene:ENSBTAG00000026266 transcript:ENSBTAT00000037254 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSKKAKTKTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASL
GKNPTDAYLEAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQED
YLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD
Download sequence
Identical sequences A4IF97 W5PL19
9913.ENSBTAP00000007878 9913.ENSBTAP00000037091 ENSTTRP00000007882 NP_001077233.1.59421 NP_001077233.1.76553 XP_004313158.1.83887 XP_005893707.1.15283 XP_005974125.1.78601 XP_006071911.1.26621 XP_006071912.1.26621 XP_007126815.1.24612 XP_007191666.1.59432 XP_007456625.1.90284 XP_010831016.1.44457 XP_011974187.1.54773 XP_012390709.1.21590 XP_012390710.1.21590 XP_014959135.1.66739 XP_017895050.1.57651 XP_019776310.1.83887 XP_019842175.1.53367 ENSOARP00000011142 ENSBTAP00000037091 ENSTTRP00000007882 ENSBTAP00000037091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]